DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and CG43366

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster


Alignment Length:473 Identity:102/473 - (21%)
Similarity:168/473 - (35%) Gaps:122/473 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHH 73
            |:.|.:....||.:.:..::    :.|.||.::.|.|::.|:||.|||:.|:...|:|......:
  Fly  1687 NELAFSYWRAITSEKISSAR----SLVISPFALTSMLSMVFLGARGSTSGEMNEILKLDDMVTFN 1747

  Fly    74 IALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSL--ELLTEFNEIAVDFFQSKAEATRFADSEGA 136
            ..|.|.....:.....|......:..|...:|..  ::|..|.|.....:....|...|      
  Fly  1748 PHLIFKNITNSVEQASDSDIATAAFVREIFSDRANGKILPFFKEKTQQLYAGHVEEVNF------ 1806

  Fly   137 TQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKW-QKPFMPETTSI---DHFH--- 194
             .::||.|.:.     ||||    |...|...::..|.....| ..|....:.::   |..|   
  Fly  1807 -HVVNDIVRRR-----TNLL----VKRHTMGKVLEYLRTNSVWVNGPLATISANLFQTDCSHGST 1861

  Fly   195 VDRD------THVQVN---------MMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLP--- 241
            .|||      .|..|.         ::|:.. |.....|.|.|..|......:.:..:.::|   
  Fly  1862 TDRDGEMFFQVHPTVRQRRLVPIPAVLYRSG-FLAGYEPSLDATVVSFGRVQNTVSTVYVMPGHQ 1925

  Fly   242 ---NEVNGLQELEQQLNTVDLADIDA----ALTLQD---VEIFLPRMCIEYDVDLKQVLNQLGIT 296
               :.::.|..||:.|.....:|..|    ..:|.|   :|:.|||......|:....|.::|:.
  Fly  1926 SSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASLGLQKMGLR 1990

  Fly   297 EVF-SDKAKLDGL------------------FTSQSGQKISAARH----------RGYIDVNEAG 332
            .:| ||.|.|.||                  |::...:|||...|          :...||:...
  Fly  1991 GLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKRNKDVDATD 2055

  Fly   333 SEA-----AAVSFMKIV---------------PMMLNMNKKL------------FKADHPFVFYI 365
            .:|     ..|.|..:|               |..|.:...|            .:.|.||::::
  Fly  2056 DDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRFDKPFLYFV 2120

  Fly   366 R-NPQA-VFFAGRFSNPK 381
            | ||.. :.|.||| ||:
  Fly  2121 RHNPTGMILFMGRF-NPR 2137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 98/467 (21%)
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 100/470 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.