DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINA9

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:361 Identity:99/361 - (27%)
Similarity:175/361 - (48%) Gaps:20/361 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFG-EFWRTSCNYGDRGP 93
            |..|..|||.||.::|.:..:||...|..::..||..........|::.| :....|.....:..
Human    64 PSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDL 128

  Fly    94 VLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQS 158
            .||..:.|:|...|:|...|.......::::..:|.|::...|...||..|:::|:.|:.:::| 
Human   129 TLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ- 192

  Fly   159 DAVNNETSALLINVLYFKGKWQKPFMPETTSIDH-FHVDRDTHVQVNMMYQEDKFRFAELPQLKA 222
             .::..|:.:|:|.::||.||:|||.||.|..:. |.|.....|.|.||:|:::|.|....:|..
Human   193 -GLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNC 256

  Fly   223 RAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLK 287
            ..:|:.|....:...: ||:: ..:::|||.|:...|.....:|..:.:|:|:||..|....:|:
Human   257 FVLQMDYKGDAVAFFV-LPSK-GKMRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLE 319

  Fly   288 QVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIV------PM 346
            .:|.::||..||...|...|:....|.| :|.|.|:..:||:|.|:||.|.:..|.:      |.
Human   320 TILPKMGIQNVFDKNADFSGIAKRDSLQ-VSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPS 383

  Fly   347 MLNMNKKLFKADHPFVFYIRN--PQAVFFAGRFSNP 380
            ...::     .:..|:..|.|  ...:.|.|:..||
Human   384 YFTVS-----FNRTFLMMITNKATDGILFLGKVENP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 97/356 (27%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.