DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpina1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:380 Identity:109/380 - (28%)
Similarity:196/380 - (51%) Gaps:31/380 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGL--------QLG 67
            ||.:|...:..:...|.|    |..|||..:..||:|..:||..||..::.:||        |:.
Zfish    73 FAFSLYKKLASNPDGQGK----NIFFSPVGISMALSLLAVGAKASTLSQIYSGLGYSALTPEQVN 133

  Fly    68 PGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFAD 132
            .|..|.:.:         ..:......|::...:.:.|..:::.:|.:.|..::.|:|....|:.
Zfish   134 EGYEHLLHM---------LGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFGVDFSK 189

  Fly   133 SEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDR 197
            .|.|...||.::.::|..||||:::.  ::.:|..:|||.:||:|||:|||..:.|....|.||:
Zfish   190 PEIAAAEINKFIARKTHDKITNMVKD--LDADTVMMLINYMYFRGKWEKPFDAKLTHKADFKVDQ 252

  Fly   198 DTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADI 262
            ||.|||:||.:..::...:.|..:...:.:||. .|..|:|:||:: ..::|||:.:....|.:.
Zfish   253 DTTVQVDMMKRTGRYDIYQDPVNQTTVMMVPYK-GNTSMMIVLPDD-GKMKELEESICRHHLKNW 315

  Fly   263 DAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYID 327
            ...|....|::|:|:..|.....|..:|..:|:|:.|:|||...|: |.:...|:|...|:..:.
Zfish   316 HDKLFRSSVDLFMPKFSISATSKLDGILKDMGMTDAFNDKADFSGM-TEEVKVKVSQVLHQAVMS 379

  Fly   328 VNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            |:|.|:||||::.::|:||.|.....|   :.||:..|  .:..::.|.|:.:||
Zfish   380 VDEKGTEAAAITTIEIMPMSLPDTVIL---NRPFLVLIVEDSTMSILFMGKITNP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 107/375 (29%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 107/375 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.