DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpine3

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:372 Identity:93/372 - (25%)
Similarity:156/372 - (41%) Gaps:77/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGD-------------RHHIALNFGE---- 80
            |.|.|||||..:|.:...||.|:|..:|...|.....|             ||:.:...|.    
Mouse    51 NFVISPASVSLSLEILQFGARGNTGWQLAGALGYTVQDPRVKEFLHAVYTTRHNSSQGVGMELAC 115

  Fly    81 --FWRTSCNYGDRGP-VLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEAT-------RFADSEG 135
              |.:|..:.   .| .::.|:| :.|.|||        |.||.:..:..|       |.:..||
Mouse   116 TLFMQTGTSL---SPCFVEQVSR-WANSSLE--------AADFSEPNSTTTEASKVTSRQSTGEG 168

  Fly   136 ATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPF------MPETTSIDHFH 194
            ....:  |.            ::||::.:.|  :::.:.|:..|||.|      :|.|    |.|
Mouse   169 PDSPL--WG------------RADALSTQLS--IMSTMTFQSTWQKRFSVVLQPLPFT----HAH 213

  Fly   195 VDRDTHVQVNMMYQEDKFRFAELPQLKARAV---QLPYDYSNIHMLILLPNEV-NGLQELEQQLN 255
               ...:||..|:|..:..:.:........:   :|.|......:|::||.:. ..|..:|..|.
Mouse   214 ---GLVLQVPAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLT 275

  Fly   256 TVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQKISA 319
            ...|......|....:::||||..|:...|:|.:|...|||::|.. ||.|.|: :.|.|..:|.
Mouse   276 ARVLHLWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITDLFDPLKANLKGI-SGQDGFYVSQ 339

  Fly   320 ARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIR 366
            ..|:..::::|.|:.::|.:   .|.::.......||||.||:|.:|
Mouse   340 LTHKAKMELSEEGTRSSAAT---AVLLLRRSRTSAFKADRPFIFLLR 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 93/372 (25%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 93/372 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.