DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina1f

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:388 Identity:77/388 - (19%)
Similarity:168/388 - (43%) Gaps:46/388 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLG----PGDRHHI 74
            |:...:.|:..|.|.:.  |.:|||..|.:|:::..:||.|:.::.:...|:|.    |....|.
  Rat    50 NISITLFKEMAQLSVNG--NILFSPIRVIAAISMLSLGAKGNESKRILEILRLNKTGLPEAEIHK 112

  Fly    75 ALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQL 139
            ..   .:...:.:..::...|||.:.::::..|..:.:|.|...:.:.|...:..|.|...|...
  Rat   113 CF---RYLLRAIHQPEQLSPLKSGSGVFIHQDLTPVDKFVEGVKNLYHSDIVSINFTDCRRAKTQ 174

  Fly   140 INDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVN 204
            ||:::..::..:|.|::::  :.|:|...::|.:.:..|....|...:.....:|:::...::|.
  Rat   175 INNYMMTKSNKEIKNIVKN--LENDTYMAVVNYIIWNAKINSDFGCRSVKQKDYHLEQGMTIKVP 237

  Fly   205 MMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQ 269
            |::..|......:..|.:..:......||.....::| ::..:|::||:|.......:.....|:
  Rat   238 MIHIVDLNHLFRVEDLSSTVLVFTLLASNFTTYFIIP-DIGQMQKVEQRLTYPHFRRMRRQSNLR 301

  Fly   270 DVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFT---SQSGQKISAARHRGYIDVNEA 331
            .|.:..|.:.:....|::.::|.||||.||::.|....:..   .:|.:.:|..:    :.:::.
  Rat   302 MVNLETPELSLSETHDVESMMNLLGITYVFNNDANSSAVMNDTLQKSFKMVSKVK----LTIDDK 362

  Fly   332 GSEAAAVSFMKIVPMMLNMNKKLFKAD-----------HPFVFYIRNP--QAVFFAGRFSNPK 381
            ||:..              ....||.|           .||:.:|::|  ....|.||..|||
  Rat   363 GSKPG--------------RSTCFKNDGSVDVGYVQFNRPFLIFIKDPTNDVPLFLGRVVNPK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 73/382 (19%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 74/385 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.