DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and RGD1564786

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:388 Identity:122/388 - (31%)
Similarity:203/388 - (52%) Gaps:28/388 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQL---- 66
            :....||..|..|:.:|.   ||    |..||..|:.|||::..|||:|:||.::...:.|    
  Rat    48 KANGNFAIKLFKVLGEDI---SK----NVFFSLPSISSALSMILMGANGTTASQICQAMSLDKCN 105

  Fly    67 --GPGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATR 129
              |.||.|...|:.    .|..|..|...:|:..|.:::.||.|:|..|.:.....::::.|...
  Rat   106 SIGGGDVHQHFLSL----LTKVNKTDTRCMLRKANSVFIEDSFEILASFKDACHKLYEAEIEELD 166

  Fly   130 FADS-EGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHF 193
            |..: |.:.|.||.||.::||..|..||....||:.|...|:||:||||..:|||....|....|
  Rat   167 FKGAPEQSRQHINTWVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPFNKADTREMPF 231

  Fly   194 HVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQL---N 255
            .|..:....|.||.|:..|:...:..:..:.:.||::.|.:.|...:|:.....::||.:|   .
  Rat   232 KVSMNEKKTVQMMSQKSTFKMTYVKDISTQVLTLPFENSILSMYFFVPDSHVAQRKLENELTYDK 296

  Fly   256 TVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVF-SDKAKLDGLFTSQSGQKISA 319
            .::..|.| .:..:::|:||||:.:|...|:..||.:||:|:.| .|||...|: :|:.|..:|.
  Rat   297 FLEWTDED-TMEEKEMEVFLPRIKLEESYDMNGVLRKLGMTDAFEEDKADFSGI-SSKHGLFLSK 359

  Fly   320 ARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQA--VFFAGRFSNP 380
            ..|:.:::::|.|:||||.:  .:|.|...:..:...|||||:|.|::.::  :.|.||||:|
  Rat   360 VVHKSFVEMSEEGTEAAAPT--DVVTMKSPLTPRCLIADHPFLFSIQDTRSKEILFLGRFSSP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 118/382 (31%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 121/386 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.