DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPIND1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:398 Identity:105/398 - (26%)
Similarity:184/398 - (46%) Gaps:60/398 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHI 74
            :||.||..|: ||.:    :...|...:|..:.:|:.:..:|..|.|.|::            |.
Human   132 KFAFNLYRVL-KDQV----NTFDNIFIAPVGISTAMGMISLGLKGETHEQV------------HS 179

  Fly    75 ALNFGEFWRTSCNY------------------GDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFF 121
            .|:|.:|...|..|                  .:.|..|:|||.||:.....:|.:|.....:::
Human   180 ILHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYY 244

  Fly   122 QSKAEATRFADSEGATQLINDWVEQETEH--KITNLLQSDAVNN---ETSALLINVLYFKGKWQK 181
            .::|:...|:|..        ::.:...|  |:|..|..||:.|   .|..:::|.:||||.|..
Human   245 FAEAQIADFSDPA--------FISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVN 301

  Fly   182 PFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNG 246
            .|..|.|...:|.::....|:|:||..:..|..|...:|....:||.| ...|.|||::|::::|
Human   302 KFPVEMTHNHNFRLNEREVVKVSMMQTKGNFLAANDQELDCDILQLEY-VGGISMLIVVPHKMSG 365

  Fly   247 LQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTS 311
            ::.||.||....:.....::|.:..|:.||:..:|.:.:|.:.|..:||..:|.....:.|:   
Human   366 MKTLEAQLTPRVVERWQKSMTNRTREVLLPKFKLEKNYNLVESLKLMGIRMLFDKNGNMAGI--- 427

  Fly   312 QSGQKIS--AARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVF--YIRNPQAVF 372
             |.|:|:  ..:|:|.|.|||.|::|..|:.:..:|:...:.   |..|.||:|  |......:.
Human   428 -SDQRIAIDLFKHQGTITVNEEGTQATTVTTVGFMPLSTQVR---FTVDRPFLFLIYEHRTSCLL 488

  Fly   373 FAGRFSNP 380
            |.||.:||
Human   489 FMGRVANP 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 102/393 (26%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 105/398 (26%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 1/19 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.