DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinc1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001012027.1 Gene:Serpinc1 / 304917 RGDID:1307404 Length:465 Species:Rattus norvegicus


Alignment Length:391 Identity:112/391 - (28%)
Similarity:199/391 - (50%) Gaps:24/391 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EPQEGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLG 67
            |..:..::||.|..     ..|..||:.:.|...||.|:.:|..:..:||..:|.::|....:..
  Rat    83 ELSKANSRFATNFY-----QHLADSKNDNDNIFLSPLSISTAFAMTKLGACNNTLKQLMEVFKFD 142

  Fly    68 -----PGDRHHIALNFGEFWRTSCNY---GDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSK 124
                 ..|:.|..     |.:.:|..   .::...|.|.|||:.:.||.....:.:::...:.:|
  Rat   143 TISEKTSDQIHFF-----FAKLNCRLYRKANKSSNLVSANRLFGDKSLTFNESYQDVSEIVYGAK 202

  Fly   125 AEATRFADS-EGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETT 188
            .:...|.:: |.:...||:||..:||.:|.:::...|::..|:.:|:|.:||||.|:..|.||.|
  Rat   203 LQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKGLWKSKFSPENT 267

  Fly   189 SIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQ 253
            ..:.||........|.|||||.||::..:.: ..:.:::|:...:|.|:::||.....|.::||:
  Rat   268 RKEPFHKVDGQSCLVPMMYQEGKFKYRRVGE-GTQVLEMPFKGDDITMVLILPKPEKSLAKVEQE 331

  Fly   254 LNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFS-DKAKLDGLFT-SQSGQK 316
            |....|.:....|:...:.:.:||..||....||:.|..:|:.::|| :|::|.|:.. .:....
  Rat   332 LTPELLQEWLDELSEVMLVVHVPRFRIEDSFSLKEQLQDMGLVDLFSPEKSQLPGIIAEGRDDLF 396

  Fly   317 ISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNP--QAVFFAGRFSN 379
            :|.|.|:.:::|||.||||||.:.:.|....||.::..|||:.||:..||..  ..:.|.||.||
  Rat   397 VSDAFHKAFLEVNEEGSEAAASTSVVITGRSLNPSRVTFKANRPFLVLIREVALNTIIFMGRVSN 461

  Fly   380 P 380
            |
  Rat   462 P 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 107/382 (28%)
Serpinc1NP_001012027.1 antithrombin-III_like 80..459 CDD:239000 108/386 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.