DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb13

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001100638.1 Gene:Serpinb13 / 304690 RGDID:1304661 Length:389 Species:Rattus norvegicus


Alignment Length:374 Identity:108/374 - (28%)
Similarity:186/374 - (49%) Gaps:36/374 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGL--QLGPGD----------------RHHIALNFG 79
            |..|||..:.:|:.:..:|..|:||.||:..|  :.|.|.                .|.......
  Rat    26 NVFFSPLGISTAIGMILLGTQGATASELQKVLYSEQGTGSSRLKSEEKEIEKTEEIHHQFQKLLT 90

  Fly    80 EFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFAD-SEGATQLINDW 143
            |..:.:.:|.     |...||||...:...|.::.:....::.:..|...|.: ::.:.:.||.|
  Rat    91 EISKPTKDYD-----LIISNRLYGERTYLFLQKYIDYVEKYYHASLEPVDFVNAADESRKKINSW 150

  Fly   144 VEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQ 208
            ||.:|..|:.:|....::|:.|..:|||.:||||.|.:.|..|.|..:.|.::::....|.||.|
  Rat   151 VESQTNEKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDFWLNKNISKPVQMMAQ 215

  Fly   209 EDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLAD--IDAALTLQDV 271
            ...|.|..|..|:|:.|.:||..|:..|.:||||:::||:::..:|:...|.:  ....|..:.|
  Rat   216 CSSFSFTLLEDLQAKIVGIPYKNSDFSMFVLLPNDIDGLEKIIDKLSPEKLVEWTSPGQLKQRKV 280

  Fly   272 EIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAA 336
            ::.|||:.:|...||:..|..:||...||:.|...|: ::.||.:.....||.::.|.|.|.||.
  Rat   281 DLRLPRLKVEETYDLQPTLEAVGIHSAFSEHADYSGM-SAHSGLQTQNFLHRSFLVVTEEGVEAT 344

  Fly   337 A---VSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQ--AVFFAGRFSNP 380
            |   |.|    .::...:.:|...:|||:|::|:.:  ::.|.||||:|
  Rat   345 AGTGVGF----KVLSAASCELVHCNHPFLFFVRHRESDSILFFGRFSSP 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 104/369 (28%)
Serpinb13NP_001100638.1 SERPIN 4..389 CDD:294093 107/372 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.