DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and LOC299282

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001376144.2 Gene:LOC299282 / 299282 RGDID:3745 Length:413 Species:Rattus norvegicus


Alignment Length:398 Identity:121/398 - (30%)
Similarity:191/398 - (47%) Gaps:42/398 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EGRNQFARNLIDVITKDALQQSK-----DPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQ 65
            :||...:..|....|..||...|     :|..|.||||.|:.:|||:..:||..||.||:..||:
  Rat    36 KGRQLHSLTLASSNTDFALSLYKKLALRNPDKNVVFSPLSISAALTILSLGAKDSTMEEILEGLK 100

  Fly    66 LGPGD--RHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEAT 128
            ....:  ...|...||...:......|:..: .:.:.|:::....:|:||.|.....:|::|...
  Rat   101 FNLTEITEEEIHQGFGHLLQRLSQPEDQVEI-NTGSALFIDKEQPILSEFQEKTRALYQAEAFIA 164

  Fly   129 RFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHF 193
            .|.....|.:||||:|..:|:.||..|. || :...||.:|:|.|.|||||:.||.|..|....|
  Rat   165 DFKQPNEAKKLINDYVSNQTQGKIAELF-SD-LEERTSMVLVNYLLFKGKWKVPFNPNDTFESEF 227

  Fly   194 HVDRDTHVQVNMM--------YQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQEL 250
            ::|....|:|.||        |..|:       :|....::|.|. .|...|.:||:: ..:|::
  Rat   228 YLDEKRSVKVPMMKIKEVTTPYVRDE-------ELSCSVLELKYT-GNASALFILPDQ-GKMQQV 283

  Fly   251 EQQLNTVDLADIDAALTLQDV-EIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSG 314
            |..|....|.....:|..:.: ::.:|:..|..|..||:||.:|||.:|||.:|.|..: |....
  Rat   284 ESSLQPETLKKWKDSLIPRIINDLRMPKFSISTDYSLKEVLPELGIKKVFSQQADLSRI-TGTKD 347

  Fly   315 QKISAARHRGYIDVNEAGSEAAAVSFMKIV----PMMLNMNKKLFKADHPFVFYI--RNPQAVFF 373
            ..:|...|:..:||:|.|:||.|.:.:..|    |..||.|:       ||:..|  .:.|::.|
  Rat   348 LYVSQVVHKAVLDVDETGTEATAATGVATVIRRQPRTLNFNR-------PFMVVITDMDSQSILF 405

  Fly   374 AGRFSNPK 381
            ..:.:|||
  Rat   406 VAKITNPK 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 118/391 (30%)
LOC299282NP_001376144.2 serpinA3_A1AC 36..413 CDD:381019 119/396 (30%)
RCL 365..389 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.