DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and LOC299277

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_008763124.2 Gene:LOC299277 / 299277 RGDID:1595900 Length:420 Species:Rattus norvegicus


Alignment Length:371 Identity:103/371 - (27%)
Similarity:182/371 - (49%) Gaps:36/371 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIAL--NFGEFWRTSCNYGD 90
            |:|:.|..|||.|:.:||....:||.|:|.:|:..||:....:...|.:  |:.:..:.....|.
  Rat    65 KNPNKNIAFSPLSISAALASLSLGAKGNTLQEILEGLKFNLTETTEIDIHQNYRDLLQRLSQPGG 129

  Fly    91 RGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNL 155
            :|.:.:: |.|:|...|::|..|.|.|...:|::..||.|..:..|.:.|||:|..:::.||..:
  Rat   130 QGQISRA-NLLFVEKHLQILNGFKEKAKALYQTEVFATDFQQTCEARKFINDYVMIQSQGKIKEM 193

  Fly   156 LQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQED---KFRFAEL 217
            :..  :...||.:::|.|.|.|:|..||.|:.|.:..|.:|....|:|.||..||   .:.:.| 
  Rat   194 VTE--LEERTSIVMLNFLLFTGQWSVPFDPDDTFMGKFILDSRRPVKVLMMKTEDLTTPYFWDE- 255

  Fly   218 PQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDV-EIFLPRMCIE 281
             :||...|:|.|......|.| ||:: ..::::|..|:...|.....:|..:.: |:.||:..:.
  Rat   256 -ELKCTVVELNYKGHGKAMFI-LPDQ-GKMEQVEASLHPGTLRKWTDSLKPRIIDELHLPKFSLS 317

  Fly   282 YDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQK---ISAARHRGYIDVNEAGSEAAAVSFMKI 343
            ....|:.:|.:|||.:||:.:|.|.|:    :|.|   :|...|...:.:.|.|:||.|.:    
  Rat   318 KTYKLENILPELGIMDVFNTQADLSGI----AGAKDVRVSQMIHNTVLGMAETGTEAEATT---- 374

  Fly   344 VPMMLNMNKKLFKADHPFVFYIR---------NPQAVFFAGRFSNP 380
               .:..|.:..|.:..||.::|         |.:.:.|..:..||
  Rat   375 ---RVEYNFRPAKLNDTFVNFVRKFLYMVLEPNSELISFMRKVINP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 101/366 (28%)
LOC299277XP_008763124.2 serpinA3_A1AC 37..417 CDD:381019 101/369 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.