DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina9

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:359 Identity:94/359 - (26%)
Similarity:186/359 - (51%) Gaps:11/359 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEE-LRN-GLQLGPGDRHHIALNFGEFWRTSCNYGD 90
            |.|..|.:|||.|:.::|.:..:||..:|..: ||: |..:.....|.|.|.|.:... |.|...
  Rat    63 KSPGQNILFSPVSISTSLAMLSLGACSATKTQILRSLGFNITHIAEHTIHLGFEQLVH-SLNECH 126

  Fly    91 RGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNL 155
            :...|:..:.|::...|:|..:|.:.....:.:|..:..|:::..|...||.:||:||:.|:.::
  Rat   127 KDLELRMGSVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFSNAVTAQAQINSYVERETKGKVVDV 191

  Fly   156 LQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDH-FHVDRDTHVQVNMMYQEDKFRFAELPQ 219
            :|.  ::::|:.:|:|.::||..|.:||....|:... |.:.:.|.|.|.||:|.:.|.|....:
  Rat   192 IQD--LDSQTAMVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVDRE 254

  Fly   220 LKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDV 284
            |....:|:.|....:...: ||.: ..:::||:.|:...|.....:|..:.:::|:|:..|....
  Rat   255 LGCSILQMDYRGDAVAFFV-LPGK-GKMRQLERSLSPRRLRRWSRSLQKRWIKVFIPKFSISASY 317

  Fly   285 DLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLN 349
            :|:.:|.::||.:.|:..|...|: |.....::|.|.|:..:||:|.|:||||.:..|::....:
  Rat   318 NLETILPEMGIRDAFNSNADFSGI-TKTHFLQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRSRD 381

  Fly   350 MNKKLFKADHPFVFYI--RNPQAVFFAGRFSNPK 381
            ........:.||:..:  :|.:::.|.|:..||:
  Rat   382 TPSSTIAFNEPFLILLLDKNTESILFLGKVENPR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 92/353 (26%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 94/359 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.