DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina16

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_853661.2 Gene:Serpina16 / 299271 RGDID:727888 Length:415 Species:Rattus norvegicus


Alignment Length:387 Identity:86/387 - (22%)
Similarity:148/387 - (38%) Gaps:88/387 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALT-LAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSC----NYGDRG 92
            |.:|||..:...|. |||               |..|..||.:..:.| |..|..    ...:.|
  Rat    67 NLIFSPLGIIVPLVLLAF---------------QDKPKARHQVLQDLG-FTVTGALDTKAASEYG 115

  Fly    93 PVLKSV-----------NRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQ 146
            .:|.::           :.|:::.:|:....|.::|...:.|......|.:...|.:.|:..:..
  Rat   116 KLLSNLLHTKNCGIYTGSLLFIDKTLKPAKTFVKLANSSYNSNVVLISFGNYGLAQKQIDLAIRA 180

  Fly   147 ETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDK 211
            .|..|||.||:  .:...|:..|.|..:|||||:.||..:.|.:.:|.::..|...|.||.:...
  Rat   181 RTHGKITKLLR--ILKPPTNLFLANYNFFKGKWKYPFNRKHTRMRYFWLEDGTKTLVPMMQRVGW 243

  Fly   212 FRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVE---- 272
            |:.....|:.:..:|||:..| |..:..||:: ...:|.|:            ||..|..|    
  Rat   244 FQLQYFSQMHSYVLQLPFTCS-ISGVFFLPDD-GKFEESEK------------ALLEQSFETWIQ 294

  Fly   273 --------IFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVN 329
                    :|.|:..|...:.|:.:.:.....::||:...|..:...::...:|.|.||..:.||
  Rat   295 PFPMSKRWLFFPKFSIPVALHLENLKHVNSNIKLFSEHMDLSRITLQKAPLTVSTAVHRVELTVN 359

  Fly   330 EAGSE---------AAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            |.|.|         .|.:.|                 :..|:..|  ....::.|.|:..||
  Rat   360 EDGEEKDESQPEPDLATLHF-----------------NRSFLLLILDETSNSLLFMGKVVNP 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 84/382 (22%)
Serpina16NP_853661.2 serpinA16_HongrES1-like 40..406 CDD:381053 86/387 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.