DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina6

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:369 Identity:91/369 - (24%)
Similarity:164/369 - (44%) Gaps:45/369 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIA 75
            ||.||...:.      :.:|..||:.||.|:..||.:..:| |..|......|..|.......|.
  Rat    41 FAFNLYQRLV------ALNPDKNTLISPVSISMALAMVSLG-SAQTQSLQSLGFNLTETSEAEIH 98

  Fly    76 LNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLI 140
            .:| ::........|.|..:...|.:::...|:|...|......:::|:|.|..|.|...|:|.|
  Rat    99 QSF-QYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEALAIDFEDWTKASQQI 162

  Fly   141 NDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNM 205
            |..|:.:|:.||.::. || :::..|.:|:|.::.:|.|:.||.||.|..:.|:|:..:.|:|.|
  Rat   163 NQHVKDKTQGKIEHVF-SD-LDSPASFILVNYIFLRGIWELPFSPENTREEDFYVNETSTVKVPM 225

  Fly   206 MYQEDK---FRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLA----DID 263
            |.|...   ||.:..|   .:.:|:.| ..|.....:||:        :.|::||..|    .||
  Rat   226 MVQSGSIGYFRDSVFP---CQLIQMDY-VGNGTAFFILPD--------QGQMDTVIAALSRDTID 278

  Fly   264 ---AALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGY 325
               ..:|.:.|.:::|:..|....|||.:|..|.|.::.::::...|  .::.........|:..
  Rat   279 RWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQSDFSG--NTKDVPLTLTMVHKAM 341

  Fly   326 IDVNEA----GSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYI 365
            :.::|.    .|...|...::..|:.:..||       ||:..:
  Rat   342 LQLDEGNVLPNSTNGAPLHLRSEPLDIKFNK-------PFILLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 91/369 (25%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 91/369 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.