DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb6e

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:387 Identity:133/387 - (34%)
Similarity:207/387 - (53%) Gaps:26/387 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQL---- 66
            |....||..::.|:.:|:   ||    |..|||.|:.|:|::..:||:|:||.::...|.|    
  Rat     6 EANATFALKVLRVLGEDS---SK----NVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCN 63

  Fly    67 --GPGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATR 129
              |.||.|....:.    .|..|..||..:||:.|.::|.||.|:|..|.:....|::::.|...
  Rat    64 GNGGGDFHQCFQSL----LTEVNKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMD 124

  Fly   130 FADS-EGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHF 193
            |..: |.:.|.||.||.::||..|..||....||:.|..:|:|..||||.|:|||..|.|....|
  Rat   125 FKGAPEQSRQHINTWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPF 189

  Fly   194 HVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVD 258
            .|.::....|.||:.:..||...:..:......|||..:.:.:.|:||:|...|:.:|.|:....
  Rat   190 KVSKNEKKIVQMMFNKSNFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEK 254

  Fly   259 LADIDAALTLQ--DVEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQKISAA 320
            |.:......:|  :|||.|||..:|...|:|.||.:||:|..|.| :|...|: :|:.|..:|..
  Rat   255 LIEWTRLENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGI-SSKPGLFLSKV 318

  Fly   321 RHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNP--QAVFFAGRFSNP 380
            .|:..::|||.|:||||.:  :||.|...::.:...|||||:|.|::.  :|:.|.||||:|
  Rat   319 VHKSVVEVNEEGTEAAAPT--EIVTMGSPLSPQCLVADHPFLFLIQDDRNKAILFLGRFSSP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 128/381 (34%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.