DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinf2

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:375 Identity:99/375 - (26%)
Similarity:171/375 - (45%) Gaps:32/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGD-RHHI 74
            |..:|..::.:.:...      |.|.||.||..||:...:||...|.|.|:..|.:..|. ..|:
  Rat    89 FTTDLFSLVAQTSTSS------NLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMGSCIPHL 147

  Fly    75 ALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQL 139
            ..:|       |...:.| .::...|:|:.....:..:|.|.:...|.:|.........|.... 
  Rat   148 LSHF-------CQNLNPG-TIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLTGRQEEDLMN- 203

  Fly   140 INDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVN 204
            ||.||::.||.||.:.| |:..:| |..||:|.::|.|.|:..|.|..|..|.||:|....|.|.
  Rat   204 INKWVKEATEGKIEDFL-SELPDN-TVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVA 266

  Fly   205 MMY-QEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVN-GLQELEQQLNTVDLADIDAALT 267
            ||: |....|:..|.|.:.:....|:. :|:..::::|.... .:.|:...|....|  ...::.
  Rat   267 MMHAQSYPLRWFLLEQPEIQVAHFPFQ-NNMSFVVIMPTYFGWNVSEVLANLTWDTL--YQPSMR 328

  Fly   268 LQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAG 332
            .:..::.||::.:|..:||...|::||:.::| ....|.|:  |.....:|:.:|:..::::|||
  Rat   329 EKPTKVRLPKLHLEQHLDLVATLSKLGLQDLF-QSPDLRGI--SDQSLVVSSVQHQSTMELSEAG 390

  Fly   333 SEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQ--AVFFAGRFSNP 380
            .||||.:...:..|.|:.    |..:.||:|:|....  ...|.|...||
  Rat   391 VEAAAATSTAMTRMSLSS----FFLNRPFIFFIMEETIGIPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 97/370 (26%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 97/370 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.