DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and HMSD

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_016881199.1 Gene:HMSD / 284293 HGNCID:23037 Length:217 Species:Homo sapiens


Alignment Length:127 Identity:42/127 - (33%)
Similarity:64/127 - (50%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SVQSALTLAFMGASGSTAEELRNGL---QLG--PGDRHH------IALNFGEFWRTSCNYGDRGP 93
            |:.|||.:.||||.|:||.::...|   ::|  .||.|.      :|:|     ||...|     
Human     2 SISSALAMVFMGAKGNTAAQMSQALCFSKIGGEDGDIHRGFQSLLVAIN-----RTDTEY----- 56

  Fly    94 VLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFA-DSEGATQLINDWVEQETE-HKIT 153
            ||::.|.|:...|.:.||.|.:....|:|:..:...|. |:|.:|..:|.||..:|: ||.|
Human    57 VLRTANGLFGEKSYDFLTGFTDSCGKFYQATIKQLDFVNDTEKSTTRVNSWVADKTKVHKGT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 42/127 (33%)
HMSDXP_016881199.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.