DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb1b

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_766640.1 Gene:Serpinb1b / 282663 MGIID:2445361 Length:382 Species:Mus musculus


Alignment Length:372 Identity:125/372 - (33%)
Similarity:190/372 - (51%) Gaps:26/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSCNYGD 90
            :...|..|..|||.|:.|:|.:.|:||.||||.:|...|.....:..|..     |...:.....
Mouse    20 KESSPTGNIFFSPFSISSSLAMVFLGAKGSTAAQLSKTLHFDSVEDIHSC-----FQSLTAEVSK 79

  Fly    91 RGP--VLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFAD-SEGATQLINDWVEQETEHKI 152
            .|.  .||..||||...:...|.||.......:.:...|..|.. ||.|.:.||.||:.:||.||
Mouse    80 LGASHTLKLANRLYGEKTYNFLPEFLASTQKMYSADLAAVDFQHASEDARKEINQWVKGQTEGKI 144

  Fly   153 TNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAEL 217
            ..||....|::.|..:|:|.:||||.|::.||...|....|.:::.....|.||||:.||.|..:
Mouse   145 PELLAKGVVDSMTKLVLVNAIYFKGIWEEQFMTRETINAPFRLNKKDTKTVKMMYQKKKFPFGYI 209

  Fly   218 PQLKARAVQLPYDYSNIHMLILLPNEV----NGLQELEQQLNTVDLADIDAALTLQ--DVEIFLP 276
            ..||.:.:::||....:.|:||||.::    .||:::|:||....|.:......|:  ||.:.||
Mouse   210 SDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEEQLTLGKLHEWTKHENLRNIDVHVKLP 274

  Fly   277 RMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQK---ISAARHRGYIDVNEAGSEAAA 337
            |..:|....|...|..||:.::||. ||.|.|:    ||.:   :|...|:.::||||.|:||||
Mouse   275 RFKMEESYILNSNLCCLGVQDLFSSGKADLSGM----SGSRDLFVSKIVHKSFVDVNEQGTEAAA 335

  Fly   338 VS--FMKIVPMMLNMNKKLFKADHPFVFYIR-NPQA-VFFAGRFSNP 380
            .:  .::::...:...:::|..||||:|:|| ||.| :.|.||..:|
Mouse   336 ATGGIIQVLCEKMPTPQEVFTVDHPFLFFIRHNPTANMIFFGRVCSP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 123/367 (34%)
Serpinb1bNP_766640.1 serpinB1_LEI 1..382 CDD:381028 124/370 (34%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 352..382 14/29 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.