DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina3b

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_766612.1 Gene:Serpina3b / 271047 MGIID:2182835 Length:420 Species:Mus musculus


Alignment Length:369 Identity:103/369 - (27%)
Similarity:176/369 - (47%) Gaps:32/369 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEELR-----NGLQLGPGDRHHIALNFGEFWRTSCN 87
            |:||.|..|||..:.:||....:||.|:|.||:.     |..:....|.|.   .|....:...:
Mouse    65 KNPHKNIAFSPFGIATALNSLTLGAKGNTLEEILEVLKFNLTETSEADIHQ---GFKHLLQRLSH 126

  Fly    88 YGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKI 152
            .||:..: ::.|.|:|...|::|.||.|.|...:.::.....|.....|.:|||.::..:|:.||
Mouse   127 PGDQVQI-RTGNALFVEKHLQILAEFKEKARALYHTEVFTANFQQPHEAMKLINSYMSNQTQGKI 190

  Fly   153 TNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMM--------YQE 209
            ..|: || ::..||.:::|.|:||.:|..||..:.|.:..|.|||..||:|.||        |..
Mouse   191 KELV-SD-MDGNTSMVIVNDLFFKAEWMVPFNSDDTFMGKFIVDRSRHVKVPMMKTKNLRTPYFR 253

  Fly   210 DKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDV-EI 273
            |:       :||...|:|.|. .|...:.:||:: ..:|::|..|....|.....:|..:.: |:
Mouse   254 DE-------ELKCTVVELNYK-GNGKAMFILPDQ-GKMQQVEASLQPGTLKKWRKSLRPRKIKEL 309

  Fly   274 FLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAV 338
            .||:..:....:|:.:|.:|||.|:||.:|.|.|: |......:|...|...:|:.|.|:|..|:
Mouse   310 HLPKFSLSQHYNLEDILPELGIRELFSTQADLSGI-TGVKNITVSEMIHSTELDMTEKGTEGDAI 373

  Fly   339 SFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            :.:....|...:.....|.:..|::.:  :....:...|:..||
Mouse   374 TIVGYNFMSAKLKPVFVKFEDQFLYIVLDQGDLWIHVMGKVINP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 101/364 (28%)
Serpina3bNP_766612.1 SERPIN 51..414 CDD:294093 101/364 (28%)
RCL 367..392 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.