DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb10

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_714955.2 Gene:Serpinb10 / 266775 RGDID:628853 Length:397 Species:Rattus norvegicus


Alignment Length:414 Identity:119/414 - (28%)
Similarity:199/414 - (48%) Gaps:69/414 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEPQEGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQ 65
            ::|..||||.|                        |||..:.::|.:.::|..|:||.::...|.
  Rat    19 LAESAEGRNIF------------------------FSPWGISTSLAMVYLGTKGTTAAQMSQVLH 59

  Fly    66 LG--------------------PGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELL 110
            .|                    .|....|..:|.........:|: ..|||..||:||..:....
  Rat    60 FGSIQDFKFGPDSEKKRKMECHSGKSEEIQSDFQTLTAKILKHGN-SYVLKIANRIYVEKTYLFH 123

  Fly   111 TEFNEIAVDFFQSKAEATRFADSEGATQL-INDWVEQETEHKITNLLQSDAVNNETSALLINVLY 174
            .::.|....:|.::.::..|.::.|..:. ||.||..:|..||.|||..|||:|:|:.:|:|.||
  Rat   124 NKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLLPDDAVDNKTTMVLVNALY 188

  Fly   175 FKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLIL 239
            |||.|:..|..:.|:...|.:::.|...|.||..:...:...:.:|:...|||.|......:|:|
  Rat   189 FKGTWEHQFSVQNTTERPFRINKTTSKPVQMMSMKQSLQVFHIEELQTIGVQLHYQNREFSLLLL 253

  Fly   240 LPNEVNGLQELE-----QQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVF 299
            ||.||.||::||     ::|:....||:   :...:|:::||:..:|...||:..|..:|:|:.|
  Rat   254 LPEEVEGLKQLERAITYEKLDKWTSADM---MDTYEVQLYLPKFKMEESYDLQSALRDMGMTDAF 315

  Fly   300 SD-KAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAA-----VSFMKIVPMMLNMNKKLFKAD 358
            :. ||....: ||:....:|...|:.::::||.|:||||     |:| :|....:.:|     ||
  Rat   316 NQGKANFSNM-TSERNLFLSNVFHKTFLEINEEGTEAAAGTGSEVNF-RIKAPSIELN-----AD 373

  Fly   359 HPFVFYIRN--PQAVFFAGRFSNP 380
            |||:|.||:  ...:.|.|||.:|
  Rat   374 HPFLFLIRHNVTNTILFYGRFYSP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 114/403 (28%)
Serpinb10NP_714955.2 SERPIN 4..397 CDD:294093 118/412 (29%)
Nuclear localization signal. /evidence=ECO:0000250 74..77 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.