DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina3n

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_113719.3 Gene:Serpina3n / 24795 RGDID:3747 Length:418 Species:Rattus norvegicus


Alignment Length:360 Identity:119/360 - (33%)
Similarity:186/360 - (51%) Gaps:12/360 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQ--LGPGDRHHIALNFGEFWRTSCNYGD 90
            ::|..|.||||.|:.:||.:..:||.|::.||:..||:  |.......|...||...:......|
  Rat    65 RNPDKNVVFSPLSISAALAVVSLGAKGNSMEEILEGLKFNLTETPETEIHRGFGHLLQRLSQPRD 129

  Fly    91 RGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNL 155
            ...: .:.|.|::...|::|.||.|.|...:|::|....|..|..|.:||||:|.::|:.||..|
  Rat   130 EIQI-STGNALFIEKRLQVLAEFQEKAKALYQAEAFTADFQQSREAKKLINDYVSKQTQGKIQGL 193

  Fly   156 LQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQED-KFRFAELPQ 219
            :.:.|  .:||.:|:|.:||||||:.||.|..|....|:..:...|:|.||..|| ...:....:
  Rat   194 ITNLA--KKTSMVLVNYIYFKGKWKVPFDPRDTFQSEFYSGKRRPVKVPMMKLEDLTTPYVRDEE 256

  Fly   220 LKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDV-EIFLPRMCIEYD 283
            |....|:|.|. .|...|.:||:: ..:|::|..|....|.....:|....: |::||:..|..|
  Rat   257 LNCTVVELKYT-GNASALFILPDQ-GKMQQVEASLQPETLRRWKDSLRPSMIDELYLPKFSISAD 319

  Fly   284 VDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMML 348
            .:|:.||.:|||.||||.:|.|.|: |......:|...|:..:||.|.|:||||.:.:|.|||..
  Rat   320 YNLEDVLPELGIKEVFSTQADLSGI-TGDKDLMVSQVVHKAVLDVAETGTEAAAATGVKFVPMSA 383

  Fly   349 NMNKKLFKADHPFVFYIRNPQAVF--FAGRFSNPK 381
            .::..:...|.||:..|.:.:...  |..:..|||
  Rat   384 KLDPLIIAFDRPFLMIISDTETAIAPFLAKIFNPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 116/354 (33%)
Serpina3nNP_113719.3 serpinA3_A1AC 37..418 CDD:381019 117/358 (33%)
RCL 367..394 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.