DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina3c

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_036789.2 Gene:Serpina3c / 24794 RGDID:2972 Length:416 Species:Rattus norvegicus


Alignment Length:400 Identity:120/400 - (30%)
Similarity:194/400 - (48%) Gaps:45/400 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EGRNQFARNLIDVITKDALQQSK-----DPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQ 65
            :||...:..|..:.|...|...|     :|..|.||||.|:.:||.:..:||..||.||:..||:
  Rat    36 KGRQLHSLTLASINTDFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEGLK 100

  Fly    66 LGPGD--RHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEAT 128
            ....:  ...|...||...:......|:..: .:.:.|:::....:|:||.|.....:|::|...
  Rat   101 FNLTEITEEEIHQGFGHLLQRLSQPEDQAEI-NTGSALFIDKEQPILSEFQEKTRALYQAEAFVA 164

  Fly   129 RFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHF 193
            .|.....|.:.|||:|..:|:.||..|. || ::..||.:|:|.|.|||||:.||.|..|....|
  Rat   165 DFKQCNEAKKFINDYVSNQTQGKIAELF-SD-LDERTSMVLVNYLLFKGKWKVPFNPNDTFESEF 227

  Fly   194 HVDRDTHVQVNMM--------YQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQEL 250
            ::|....|:|.||        |..|:       :|....::|.|. .|...|.:||:: ..:|::
  Rat   228 YLDEKRSVKVPMMKIKDLTTPYVRDE-------ELSCSVLELKYT-GNASALFILPDQ-GKMQQV 283

  Fly   251 EQQLNTVDLADIDAALTLQDV-EIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSG 314
            |..|....|.....:|..:.: |:.:|:..|..|.:|::||.:|||.::||.:|.|..: |....
  Rat   284 ESSLQPETLKKWKDSLRPRIISELRMPKFSISTDYNLEEVLPELGIRKIFSQQADLSRI-TGTKN 347

  Fly   315 QKISAARHRGYIDVNEAGSEAAA----VSFMKIVPM---MLNMNKKLFKADHPFVFYI--RNPQA 370
            ..:|...|:..:||:|.|:|.||    .:.:|.:|.   :||.|:       ||:..|  .|.|:
  Rat   348 LHVSQVVHKAVLDVDETGTEGAAATAVTAALKSLPQTVPLLNFNR-------PFMLVITDNNGQS 405

  Fly   371 VFFAGRFSNP 380
            |||.|:.:||
  Rat   406 VFFMGKVTNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 118/394 (30%)
Serpina3cNP_036789.2 SERPIN 54..415 CDD:214513 114/380 (30%)
RCL 365..392 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.