DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_071964.2 Gene:Serpina1 / 24648 RGDID:3326 Length:411 Species:Rattus norvegicus


Alignment Length:387 Identity:127/387 - (32%)
Similarity:204/387 - (52%) Gaps:36/387 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QFARNLIDV---ITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGL-----QL 66
            :.:.||.|.   :.::.:.||...  |..|||.|:.:|..:..:|:.|.|.:::..||     |:
  Rat    43 KISSNLADFAFSLYRELVHQSNTS--NIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQI 105

  Fly    67 GPGDRH---HIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEAT 128
            ...|.|   |..|.       :.|..|....|.:.|.|:||.:|:|:.:|.|...:.:.|:|.:.
  Rat   106 PEADIHKAFHHLLQ-------TLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSV 163

  Fly   129 RFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHF 193
            .|||||.|.::|||:||:.|:.||.:|::.  ::.:|...|:|.::|||||::||.||.|....|
  Rat   164 NFADSEEAKKVINDYVEKGTQGKIVDLMKQ--LDEDTVFALVNYIFFKGKWKRPFNPEHTRDADF 226

  Fly   194 HVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVD 258
            |||:.|.|:|.||.:...|.......|.:..:.:.| ..|...:.|||:: ..:|.|||.| |.|
  Rat   227 HVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDY-LGNATAIFLLPDD-GKMQHLEQTL-TKD 288

  Fly   259 LADIDAALTLQDVE---IFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAA 320
            |  |...|..:...   ::.|::.|....:||.:|:.||||.||::.|.|.|: |..:..|:|.|
  Rat   289 L--ISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGI-TEDAPLKLSQA 350

  Fly   321 RHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            .|:..:.::|.|:|||..:.::.|||.|....|.   ||||:|.|  ...|:..|.|:..:|
  Rat   351 VHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKF---DHPFIFMIVESETQSPLFVGKVIDP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 126/382 (33%)
Serpina1NP_071964.2 alpha-1-antitrypsin_like 49..406 CDD:239011 124/376 (33%)
RCL 367..386 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.