DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina4

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_659565.2 Gene:Serpina4 / 246328 RGDID:708581 Length:423 Species:Rattus norvegicus


Alignment Length:399 Identity:110/399 - (27%)
Similarity:181/399 - (45%) Gaps:53/399 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGL------- 64
            |...||..|..:|.      |::...|..|||.|:..:|.:...||.|.|..::..||       
  Rat    51 GNANFAFRLYHLIA------SQNSEKNIFFSPLSISVSLAILSTGAGGDTQAQILEGLGFNLTKL 109

  Fly    65 ---QLGPGDR---HHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQS 123
               ::..|.|   |.||..|.|            |.:...:.|.::.:|::|:||.......:.|
  Rat   110 SLPEIHEGFRSLQHTIARPFTE------------PQISVGSALILSQNLQILSEFVSAIETSYNS 162

  Fly   124 KAEATRFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETT 188
            |.....|.|.|.|.||||::|:|.|:.||.||: || ::.:...:|:|.::|:|.|:|||.....
  Rat   163 KVLHANFRDKEAAVQLINNYVKQNTQGKIKNLV-SD-LSPDVKMVLVNYIFFQGLWKKPFPSSRV 225

  Fly   189 SIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDY-SNIHMLILLPNEVNGLQELEQ 252
            |...|:||.:|.|::.||.| ||.....|...:.....|..|| .:.....:||:: ..:.|:||
  Rat   226 STSDFYVDENTVVKIPMMLQ-DKEDHWYLEDRRVPCTVLRMDYRGDAVAFFILPDQ-GKMNEVEQ 288

  Fly   253 QLNTVDLAD----IDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQS 313
            .|:...|..    :......:.:.:.||:..|....:|.::|..||..::|:..|....: :.:.
  Rat   289 VLSPGMLLRWKRLLQNRFFYRKLILQLPKFSISNSYELDEILPDLGFQDLFTPNANFSNI-SKKE 352

  Fly   314 GQKISAARHRGYIDVNEAGSEAAA-----VSFMKIVPMMLNMNKKLFKADHPF--VFYIRNPQAV 371
            ...:|...|:..:||||.|::|||     .:|....|     .|:....:.||  :.|..:.|.:
  Rat   353 KLYLSKVFHKTVLDVNEVGTKAAAATGSFATFFSAQP-----KKRYLIFNRPFLVILYSTSSQDI 412

  Fly   372 FFAGRFSNP 380
            .|.|:..||
  Rat   413 LFMGKVVNP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 108/394 (27%)
Serpina4NP_659565.2 SERPIN 52..418 CDD:294093 107/393 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.