DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb10

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:314 Identity:81/314 - (25%)
Similarity:150/314 - (47%) Gaps:47/314 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LAFMGASGSTAEELRNGLQLGPGD----------RHHIALNFGEFWRTSCNY---------GDRG 92
            :.::|..|:||:::...||....:          :..:..|.|:|.....::         ....
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly    93 PVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQL-INDWVEQETEHKITNLL 156
            .|||:.||:|...:.....::.|....:|.::.::..|.::.|..:. ||.||..:|..||.|||
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLL 130

  Fly   157 QSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLK 221
            ..|:|:.:|..:|:|.|||||.|:..|..::|:...|.|::.|...|.||..:...:...:.:|:
Mouse   131 PDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIEELQ 195

  Fly   222 ARAVQLPYDYSNIHMLILLPNEVNGLQELE-----QQLNTVDLADIDAALTLQDVEIFLPRMCIE 281
            ...:||.|...::.:|:|||..::||::||     ::|:....||:   :...:|:::||:..:|
Mouse   196 TIGLQLHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADM---MDTYEVQLYLPKFKME 257

  Fly   282 YDVDLKQVL-------------NQLGITEVFSDKAKLDGLFTSQSGQKISAARH 322
            ...|||..|             |:..:..::|  |.||   ..|:|..:| .||
Mouse   258 ESYDLKSALRGQKFSGPYSKENNEDHLPHIYS--ATLD---NQQNGHPVS-PRH 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 81/314 (26%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 71/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.