DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb6d

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001070258.1 Gene:Serpinb6d / 238568 MGIID:2667783 Length:375 Species:Mus musculus


Alignment Length:385 Identity:123/385 - (31%)
Similarity:204/385 - (52%) Gaps:33/385 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGP------ 68
            :||..|:..:..|.   ||    |...||.|:.|:|.:..:||..:||.::|..|.|..      
Mouse    10 KFAFKLLKALDDDT---SK----NIFLSPPSIASSLAMTLLGAKENTARQIRQTLSLDKCSSDPC 67

  Fly    69 GDRH---HIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRF 130
            .|.|   |:.||       ..|..|.|.:||:.|||:|..:..:...|.:.:..|::::.|...|
Mouse    68 EDIHQDFHLLLN-------EVNKTDPGIILKTENRLFVEKTFHIKKSFKDASQKFYKAEIEELDF 125

  Fly   131 -ADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFH 194
             .|:|.:.|.||.||.:.|:.||.:||...:||:.|..:|:|..||||.|:|||..|.|....|.
Mouse   126 KGDTEQSRQHINTWVTKNTDEKIKDLLSPGSVNSNTRLVLVNDFYFKGYWEKPFNKEDTREMPFR 190

  Fly   195 VDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQL---NT 256
            |.::....|.||:|:..|:...:.::..:.:.|||..:.::|:|:||:|...|:.||:::   ..
Mouse   191 VSKNVVKPVQMMFQKSTFKITYIEEISTKILLLPYAGNKLNMIIMLPDEHVELRMLEKKMTYEKF 255

  Fly   257 VDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQKISAA 320
            |:...:| .:..::||:||||..:|...|:..||.::|:|:.|.: :|...|: :|:.|..:|..
Mouse   256 VEWTSLD-KMNEEEVEVFLPRFKLEEIYDMNNVLYKMGMTDAFEEGRADFSGI-SSKQGLFLSKV 318

  Fly   321 RHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQAVFFAGRFSNP 380
            .::.:|:|.|.|::.||.:  .||.|..:.....|.|||||:| ....:.....||||:|
Mouse   319 IYKAFIEVIEKGTKVAAAT--DIVMMGASPTTHTFCADHPFIF-THMTEDFMIIGRFSSP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 119/380 (31%)
Serpinb6dNP_001070258.1 SERPIN 4..375 CDD:294093 122/383 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2787
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3599
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.