DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb8

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_035589.1 Gene:Serpinb8 / 20725 MGIID:894657 Length:374 Species:Mus musculus


Alignment Length:400 Identity:131/400 - (32%)
Similarity:207/400 - (51%) Gaps:46/400 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEPQEGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQ 65
            |.:..|....||.:|:.::::      ||...|..|.|.||.|||.:.::||.|:||.::...|.
Mouse     1 MDDLSEANGSFAISLLKILSE------KDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSEVLG 59

  Fly    66 L-GPGDRHH-IALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEAT 128
            | |.||.|. ......|..:|...|     :|||..||:..:|.:.|:.|.|....|:|:..|..
Mouse    60 LSGNGDVHQSFQTLLAEINKTDTQY-----LLKSACRLFGEESCDFLSTFKESCHKFYQAGLEEL 119

  Fly   129 RFA-DSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDH 192
            .|| |:||..:.|||||.::||.||:.:|....|...|..:|:|.:||||||:..|..:.|....
Mouse   120 SFAKDTEGCRKHINDWVSEKTEGKISEVLSPGTVCPLTKLVLVNAMYFKGKWKAQFDRKYTRGMP 184

  Fly   193 FHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTV 257
            |..:::... |.||::..||:...:.::..:.:.|||....:.|:||||:|            :.
Mouse   185 FKTNQEKKT-VQMMFKHAKFKMGHVDEVNMQVLALPYAEEELSMVILLPDE------------ST 236

  Fly   258 DLADIDAALTLQ--------------DVEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDG 307
            |||.::.|||.:              .|::||||:.:|...||:.||..||:|:.|.: :|...|
Mouse   237 DLAVVEKALTYEKLRAWTNPETLTESQVQVFLPRLKLEESYDLETVLQNLGMTDAFEETRADFSG 301

  Fly   308 LFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQA 370
            : |::....:|...|:.:::|||.|:||||.:.: |........:..|.|||||:|:|  ....:
Mouse   302 M-TTKKNVPVSKVAHKCFVEVNEEGTEAAAATAV-IRNARCCRTEPRFCADHPFLFFIWHHKTSS 364

  Fly   371 VFFAGRFSNP 380
            :.|.||||:|
Mouse   365 ILFCGRFSSP 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 125/389 (32%)
Serpinb8NP_035589.1 SERPIN 4..374 CDD:294093 129/395 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2787
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3599
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.