DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina3n

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:373 Identity:118/373 - (31%)
Similarity:184/373 - (49%) Gaps:38/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSCNYGDRG 92
            |:|..|.||||.|:.:||.:..:||.|:|.||:..||:          .|..|......:.| .|
Mouse    65 KNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLK----------FNLTETSEADIHQG-FG 118

  Fly    93 PVLKSVNR------------LYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVE 145
            .:|:.:|:            |::....::||||.|.|...:|::|....|.....|.:||||:|.
Mouse   119 HLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKARALYQAEAFTADFQQPRQAKKLINDYVR 183

  Fly   146 QETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQED 210
            ::|:..|..|: || ::..|..:|:|.:|||.||:.||.|..|....|:..:...|.|.||..||
Mouse   184 KQTQGMIKELV-SD-LDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMED 246

  Fly   211 ----KFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDV 271
                .||..|   |....|:|.|. .|...:.:||:: ..:|::|..|....|.....:|..:.:
Mouse   247 LTTPYFRDEE---LFCTVVELKYT-GNASAMFILPDQ-GKMQQVEASLQPETLRKWKNSLKPRMI 306

  Fly   272 -EIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEA 335
             |:.||:..|..|..|:.||::|||.||||.:|.|..: |.....::|...|:..:||.|.|:||
Mouse   307 DELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAI-TGTKDLRVSQVVHKAVLDVAETGTEA 370

  Fly   336 AAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQAVF--FAGRFSNPK 381
            ||.:.:|.|||...:.......:.||:..|.:.:...  |..:.:|||
Mouse   371 AAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 115/367 (31%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 116/371 (31%)
RCL 367..392 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.