DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina1d

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_033272.1 Gene:Serpina1d / 20703 MGIID:891968 Length:413 Species:Mus musculus


Alignment Length:382 Identity:117/382 - (30%)
Similarity:198/382 - (51%) Gaps:23/382 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NQFARNLIDV---ITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQL---- 66
            ::.|.||.|.   :.::.:.||...  |..|||.|:.:|..:..:|:.|.|..::..|||.    
Mouse    42 HEIATNLGDFALRLYRELVHQSNTS--NIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQ 104

  Fly    67 -GPGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRF 130
             ...|.|.   :|....:| .|..|....|.:.|.|:||:.|:|:.:|.|.|.:.:|::..:..|
Mouse   105 TSEADIHK---SFQHLLQT-LNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNF 165

  Fly   131 ADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHV 195
            |:||.|.::|||:||:.|:.||...::.  ::.:|...|.|.:.|||||::||.||.|....|||
Mouse   166 AESEEAKKVINDFVEKGTQGKIVEAVKK--LDQDTVFALANYILFKGKWKQPFDPENTEEAEFHV 228

  Fly   196 DRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLA 260
            |..|.|:|.||.............|.:..:.:.| ..|...:.|||:: ..:|.|||.||...::
Mouse   229 DESTTVKVPMMTLSGMLDVHHCSMLSSWVLLMDY-AGNTTAVFLLPDD-GKMQHLEQTLNKELIS 291

  Fly   261 DIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGY 325
            .........|.:|.:||:.|..:.:||.:::.||||.:|::.|.|.|:....:..|:|.|.|:..
Mouse   292 QFLLNRRRSDAQIHIPRLSISGNYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSKAVHKAV 356

  Fly   326 IDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            :.::|.|:||||.:.:::....:   ..:.:.||||:|.|  .:.|:..|.|:..:|
Mouse   357 LTIDETGTEAAAATVLQVATYSM---PPIVRFDHPFLFIIFEEHTQSPIFVGKVVDP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 116/377 (31%)
Serpina1dNP_033272.1 SERPIN 53..410 CDD:214513 112/369 (30%)
RCL 368..387 1/21 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.