DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinf1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_035470.3 Gene:Serpinf1 / 20317 MGIID:108080 Length:417 Species:Mus musculus


Alignment Length:369 Identity:94/369 - (25%)
Similarity:165/369 - (44%) Gaps:29/369 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSCNY 88
            |:.|..|..|.:.||.||.:||:...:||...|...:...|.........|...:.|. ..|...
Mouse    67 LRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKEL-LASVTA 130

  Fly    89 GDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQL--INDWVEQETEHK 151
            .::.  |||.:|:.....|.:.:.|   .....:|.....|.........|  ||:||:.:.:.|
Mouse   131 PEKN--LKSASRIVFERKLRVKSSF---VAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQMKGK 190

  Fly   152 ITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDK--FRF 214
            |..  .:..:.:..|.||:.|.||||:|...|....|::..||:|.|..|:|.|| .:.|  .|:
Mouse   191 IAR--STREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDRTVRVPMM-SDPKAILRY 252

  Fly   215 AELPQLKARAVQLPYDYSNIHMLILLPNEV-NGLQELEQQLNTVDLADIDAAL-TLQDVEIFLPR 277
            .....|..:..|||.. .::.::..||..| ..|..:|:.|.:..:.|||..| |:|.| :.:|:
Mouse   253 GLDSDLNCKIAQLPLT-GSMSIIFFLPLTVTQNLTMIEESLTSEFIHDIDRELKTIQAV-LTVPK 315

  Fly   278 MCIEYDVDLKQVLNQLGITEVFS--DKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSF 340
            :.:.::.:|.:.|..:.:..:|.  |.:|:.|     ...|::...||...:.||.|:.::....
Mouse   316 LKLSFEGELTKSLQDMKLQSLFESPDFSKITG-----KPVKLTQVEHRAAFEWNEEGAGSSPSPG 375

  Fly   341 MKIVPMMLNMNKKLFKADHPFVFYIRNPQ--AVFFAGRFSNPKS 382
            ::.|.:...::   :..:.||:|.:|:..  |:.|.||..:|.|
Mouse   376 LQPVRLTFPLD---YHLNQPFLFVLRDTDTGALLFIGRILDPSS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 91/362 (25%)
Serpinf1NP_035470.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..41
PEDF 39..414 CDD:239007 92/365 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.