DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb3a

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_033152.3 Gene:Serpinb3a / 20248 MGIID:3573933 Length:387 Species:Mus musculus


Alignment Length:379 Identity:112/379 - (29%)
Similarity:198/379 - (52%) Gaps:21/379 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGP------------GDRH 72
            |.:..:|.::...|..:||.|:.:||.:..:||.|:|.:::...||...            .|..
Mouse    12 TLELYRQLRESDNNIFYSPISMMTALAMLQLGAKGNTEKQIEKVLQFNETTKKTTEKSAHCHDEE 76

  Fly    73 HIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFAD-SEGA 136
            ::...|.:. .|..|..:....||:.|.:|.......:..|.|...:::|:..|:..|.. :|.:
Mouse    77 NVHEQFQKL-MTQLNKSNDAYDLKAANSIYGAKGFPFVQTFLEDIKEYYQANVESLDFEHAAEES 140

  Fly   137 TQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHV 201
            .:.||.|||.:|..||.:|..:.::|..|..:|:|.:||||:|...|..:.|:.:.|.::::|..
Mouse   141 EKKINSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTEEKFWLNKNTSK 205

  Fly   202 QVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAAL 266
            .|.||.|..:|.|..|..::|:.|::||....:.|::|||.|:|||::||:||....|.:...|.
Mouse   206 PVQMMKQNIEFNFMFLEDVQAKIVEIPYKGKELSMIVLLPVEINGLKQLEEQLTADKLLEWTRAE 270

  Fly   267 TLQDVEIF--LPRMCIEYDVDLKQVLNQLGITEVFS-DKAKLDGLFTSQSGQKISAARHRGYIDV 328
            .:...|::  |||..::...||...|..:|:.:.|. .||...|:.::| |..:|...|:.:::|
Mouse   271 NMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDPQKADFSGMSSTQ-GLVVSKVLHKSFVEV 334

  Fly   329 NEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNP 380
            ||.|:||||.:.:::......:.:. |..||||:|:|  |...::.|.||.|:|
Mouse   335 NEEGTEAAAATGVEVSLTSAQIAED-FCCDHPFLFFIIHRKTNSILFFGRISSP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 109/374 (29%)
Serpinb3aNP_033152.3 SERPIN 5..387 CDD:294093 111/377 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.