DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina12

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:380 Identity:105/380 - (27%)
Similarity:186/380 - (48%) Gaps:31/380 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGL---QLGPGDR 71
            :|...|:..:..::.|.      |...||.|:.:|.::..:||..||.||:|.|.   ::...|.
  Rat    54 EFGFKLLQRLASNSRQG------NIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSDRDM 112

  Fly    72 H---HIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADS 133
            |   |..|.       ..|...:...:...|.|:::..|.....|.::|.:.:.:....|.|.|.
  Rat   113 HMGFHYLLQ-------KLNRETQDVKMSIGNALFMDQRLRPQQRFLKLAKNLYDADMILTNFQDL 170

  Fly   134 EGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRD 198
            |...:.||.::.::|.::|.|::::  ::..|..||.|.:||:|:||..|.|:.|..:.|.::..
  Rat   171 ENTQKNINKYISRKTHNRIENMVKN--IDPGTVMLLTNYIYFQGRWQYEFDPKQTKEEDFFIEEG 233

  Fly   199 THVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADID 263
            ..|:|.||:|...:..|...||....:::|| ..||....:||:. ..|:.|||.|.....|...
  Rat   234 KTVKVPMMFQRGMYDMAYDSQLSCTILEMPY-RRNITATFVLPDS-GKLRLLEQGLQADIFAKWK 296

  Fly   264 AALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDV 328
            :.|:.:.|::::||:.|....::|:||::|||:::|.:...|..: :|....|:..|.|:..:.:
  Rat   297 SLLSKRVVDVWVPRLHISATYNMKKVLSRLGISKIFEEHGDLTRI-SSHRSLKVGEAVHKAELRM 360

  Fly   329 NEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRN---PQAVFFAGRFSNP 380
            ||.|:|.||.|..:.:||......||   :.||:..|..   |..:|.| |..||
  Rat   361 NEKGTEGAAGSGAQTLPMETPRRMKL---NAPFLMMIYENLMPSMIFLA-RIYNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 102/375 (27%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 102/375 (27%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.