DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinf2

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_032904.1 Gene:Serpinf2 / 18816 MGIID:107173 Length:491 Species:Mus musculus


Alignment Length:387 Identity:101/387 - (26%)
Similarity:174/387 - (44%) Gaps:56/387 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGD-RHHI 74
            |..:|..::.:.:...      |.|.||.||..||:...:||...|...|...|.:..|. ..|:
Mouse    89 FTTDLFSLVAQTSTSS------NLVLSPLSVALALSHLALGAQNQTLHSLHRVLHMNTGSCLPHL 147

  Fly    75 ALNFGEFWRTSCNYGDRGP-VLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQ 138
            ..:|         |.:.|| .::...|:|:.....:..:|.|.:...|.:|.........|....
Mouse   148 LSHF---------YQNLGPGTIRLAARIYLQKGFPIKDDFLEQSERLFGAKPVKLTGKQEEDLAN 203

  Fly   139 LINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQV 203
             ||.||::.||.||.:.|..  :.:.|..||:|.::|.|.|:..|.|..|..|.||:|....|.|
Mouse   204 -INQWVKEATEGKIEDFLSE--LPDSTVLLLLNAIHFHGFWRTKFDPSLTQKDFFHLDERFTVSV 265

  Fly   204 NMMYQED-KFRFAELPQLKARAVQLPYDYSNIHMLILLPN--EVNGLQELEQQLNTVDLADIDAA 265
            :||:... ..|:..|.|.:.:....|:. :|:..::::|.  |.|             ::::.|.
Mouse   266 DMMHAVSYPLRWFLLEQPEIQVAHFPFK-NNMSFVVVMPTYFEWN-------------VSEVLAN 316

  Fly   266 LT--------LQD--VEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAA 320
            ||        ||:  .:::||::.::..:||...|:|||:.|:|.. ..|.|:  |:....:|:.
Mouse   317 LTWDTLYHPSLQERPTKVWLPKLHLQQQLDLVATLSQLGLQELFQG-PDLRGI--SEQNLVVSSV 378

  Fly   321 RHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQ--AVFFAGRFSNP 380
            :|:..::::|||.||||.:.:    .|..|:...|..:.||:|:|....  ...|.|...||
Mouse   379 QHQSTMELSEAGVEAAAATSV----AMNRMSLSSFTVNRPFLFFIMEDTIGVPLFVGSVRNP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 99/382 (26%)
Serpinf2NP_032904.1 alpha2AP 82..433 CDD:239008 99/382 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..491
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.