DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpine1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:398 Identity:112/398 - (28%)
Similarity:183/398 - (45%) Gaps:73/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGL------------------- 64
            :.:..:|.|||.  |.||||..|.|.|.:..|..:|.|..::::.:                   
Mouse    42 VFQQVVQASKDR--NVVFSPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHALRQLSKE 104

  Fly    65 QLGPGDRHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATR 129
            .:||.:::.|:                     :.:.::|...|||:..|.......||:..:...
Mouse   105 LMGPWNKNEIS---------------------TADAIFVQRDLELVQGFMPHFFKLFQTMVKQVD 148

  Fly   130 FADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFH 194
            |::.|.|..:||||||:.|:..|::||...||:..|..:|:|.|||.|:|:.||:..:|....||
Mouse   149 FSEVERARFIINDWVERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFH 213

  Fly   195 VDRDTHVQVNMMYQEDKFRFAELPQ---LKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNT 256
            ....:.|.|.||.|.:||.:.|...   |:...|:|||....:.|.|..|        .|:.::.
Mouse   214 KSDGSTVSVPMMAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAP--------FEKDVHL 270

  Fly   257 VDLADI-DAALTLQ--------DVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQ 312
            ..|.:| ||.|..|        ...:.||:..:|.:|||:..|.:||:.::||  |.|.. |||.
Mouse   271 SALTNILDAELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFS--ATLAD-FTSL 332

  Fly   313 SGQK---ISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIR-NP-QAVF 372
            |.|:   ::.|..:..|:|||:|:.|::.:...|...|......:   |..|:|.:| || :.:.
Mouse   333 SDQEQLSVAQALQKVRIEVNESGTVASSSTAFVISARMAPTEMVI---DRSFLFVVRHNPTETIL 394

  Fly   373 FAGRFSNP 380
            |.|:...|
Mouse   395 FMGQVMEP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 111/393 (28%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 111/396 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.