DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpini2

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001127881.1 Gene:Serpini2 / 171149 RGDID:619897 Length:405 Species:Rattus norvegicus


Alignment Length:412 Identity:109/412 - (26%)
Similarity:196/412 - (47%) Gaps:46/412 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEPQEGRNQFARN---LIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRN 62
            :|..|..|....:|   .:|:....:|....    |.:|||......|.:..:||.|...:::..
  Rat    13 LSGSQTSRTMDQKNAEFAVDLYKAISLSNKN----NVIFSPLGTTVLLGMVQLGAKGKAQQQIMQ 73

  Fly    63 GLQLGPGDRHHIALNFGEFWRTSCNYGDRGPVLKSV----------------NRLYVNDSLELLT 111
            .|::               .:||.  |:...||||:                :.||:.:...:..
  Rat    74 TLRM---------------QKTST--GEEFSVLKSLFSAISKKKQEFTFNLASALYLQEGFIVKE 121

  Fly   112 EFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFK 176
            .:.....:||||..:...|.|::.:.|.|:.|||.:|:.||.|:...:.....|..:|:|.:|||
  Rat   122 SYLHSNKEFFQSATKLVDFLDAKTSAQAISTWVESKTDGKIKNMFSEEDFGPLTRLVLVNAIYFK 186

  Fly   177 GKWQKPFMPETTSIDHFHVDRDTHVQVNMM--YQEDKFRFAELPQLKARAVQLPYDYSNIHMLIL 239
            |.|::.|..|.|.:..|.....:.|::.||  ....|:.:.....:..:.::|||......::||
  Rat   187 GDWKQKFRKEDTEMTDFSKKDGSTVKIPMMKALLRAKYGYFSESSMTYQVLELPYKADEFSLVIL 251

  Fly   240 LPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAK 304
            ||.|...::|:|:|:....:....:.|..::||:.|||..||..:|.|:.|..|.:||:||....
  Rat   252 LPTEDVNIEEVEKQVTARHVQKWFSELHEEEVEVSLPRFKIEQKLDFKEALFSLNVTEIFSGGCD 316

  Fly   305 LDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQ 369
            |.|: |..|...:|.|..:.:.::||.||||||.:.:.| |.::::.:..|.|:|||:|.:::.|
  Rat   317 LSGI-TDSSELYVSRAMQKVFFEINEDGSEAAASTGINI-PAIMSLTQTQFLANHPFLFIMKHIQ 379

  Fly   370 --AVFFAGRFSNPKSGSGSGEE 389
              ::.|.|:.::|...:..|.:
  Rat   380 TESILFMGKVTDPDIHTVKGRD 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 105/392 (27%)
Serpini2NP_001127881.1 SERPIN 23..405 CDD:294093 106/402 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.