DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina3c

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_011242304.1 Gene:Serpina3c / 16625 MGIID:102848 Length:436 Species:Mus musculus


Alignment Length:370 Identity:116/370 - (31%)
Similarity:187/370 - (50%) Gaps:35/370 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLG-----PGDRHHIALNFGEFWRTSCN 87
            |:|..|.||||.|:.:||.:..:||.|:|.||:..||...     ..|.|.   .||...:...:
Mouse    84 KNPDTNIVFSPLSISAALAIVSLGAKGNTLEEILEGLNFNLTETPEADIHQ---GFGHLLQRLSH 145

  Fly    88 YGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKI 152
            .|::..: .:.:.|:|...|::|.||.|.|...:|::|....|.....||:||||:|..:|:.||
Mouse   146 PGEQVQI-STGSALFVEKHLQILAEFQEKARALYQAEAFTADFQQPLEATKLINDYVSNQTQRKI 209

  Fly   153 TNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAEL 217
            ..|: || ::.:|..:|:|.:||||||:.||.|..|....|::|....|:|.||    |.:....
Mouse   210 KGLI-SD-LDTDTLMVLVNYIYFKGKWKMPFNPRDTFESEFYLDVKRSVKVPMM----KIKTLTT 268

  Fly   218 P-----QLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDV-EIFLP 276
            |     :|....|:|.|. .|...|.:||:: ..:|::|..|....|.....:|..:.: |::||
Mouse   269 PYFRDEELSCTVVELKYK-GNASALFILPDQ-GRMQQVEASLQPETLRKWKNSLRPRKMGELYLP 331

  Fly   277 RMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQK---ISAARHRGYIDVNEAGSEAAAV 338
            :..|..|..||.:|.:|||.|:||.:|.|.|:    :|.|   :|...|:..:||.|.|:|..|.
Mouse   332 KFSISTDYSLKNILPELGIKEIFSKQADLSGI----TGTKDLIVSQMVHKAVLDVAETGTEGVAA 392

  Fly   339 SFMKIVPMMLNMNKKLFKADHPFVFYIRNP--QAVFFAGRFSNPK 381
            :.:..  .:|:....|: .:..|:..|.:.  |...|..:.::||
Mouse   393 TGVNF--RILSRRTSLW-FNRTFLMVISHTDVQTTLFIAKITHPK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 114/364 (31%)
Serpina3cXP_011242304.1 serpinA3_A1AC 56..434 CDD:381019 114/368 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.