DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and SERPINA12

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:413 Identity:100/413 - (24%)
Similarity:197/413 - (47%) Gaps:67/413 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEPQEGRNQFARNLIDVITKDALQQSKD-------------PHINTVFSPASVQSALTLAFMGA 52
            :||.|..:.:.|       .|:..:|:.|             |..|...||.|:.:|.::..:||
Human    33 LSEVQGWKQRMA-------AKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGA 90

  Fly    53 SGSTAEELRNGL---QLGPGDRHH---------------IALNFGEFWRTSCNYGDRGPVLKSVN 99
            ..||.:|::.|.   ::...|.|.               :.|:.|                   |
Human    91 QDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIG-------------------N 136

  Fly   100 RLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQSDAVNNE 164
            .|:::..|:...:|.|.|.:|:.::...|.|.:.|.|.:.|||::.|:|..||.||:::  ::..
Human   137 TLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIEN--IDPG 199

  Fly   165 TSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPY 229
            |..||.|.::|:.:|:..|.|..|..:.|.:::::.|:|.||::...::.....:|....:::||
Human   200 TVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPY 264

  Fly   230 DYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLG 294
            . .||..:.:||:| ..|:.||:.|.....:.....|:.:.|::.:||:.:....|||:.|:.:|
Human   265 Q-KNITAIFILPDE-GKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIG 327

  Fly   295 ITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADH 359
            ::::|.:...|..:...:| .|:..|.|:..:.::|.|:|.||.:..:.:||...:   :.|.|.
Human   328 VSKIFEEHGDLTKIAPHRS-LKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPL---VVKIDK 388

  Fly   360 PFVFYIRNPQ--AVFFAGRFSNP 380
            |::..|.:.:  :|.|.|:..||
Human   389 PYLLLIYSEKIPSVLFLGKIVNP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 95/402 (24%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 95/404 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.