DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpina6

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:361 Identity:91/361 - (25%)
Similarity:167/361 - (46%) Gaps:32/361 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRN-GLQLGPGDRHHI 74
            ||.||...:.  ||...|    ||:.||.|:..||.:..:...||| :.|.| |..:.......|
Mouse    41 FAFNLYKRLV--ALNSDK----NTLISPVSISMALAMLSLSTRGST-QYLENLGFNMSKMSEAEI 98

  Fly    75 ALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQL 139
            ...| ::..:.....|.|..:...|.:::..:|:|...|......:::|:|......|...|.:.
Mouse    99 HQGF-QYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQ 162

  Fly   140 INDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVN 204
            ||:.|:.:|:.||.::: || :::..:.:|||.::.||.|:.||.||.|..:.|:|:..:.|:|.
Mouse   163 INNHVKNKTQGKIEHVV-SD-LDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVP 225

  Fly   205 MMYQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTV------DLADID 263
            ||.|.....:.....:..:.||:.| ..|....|:||:        :.|::||      |..|..
Mouse   226 MMVQSGNISYFRDSAIPCQMVQMNY-VGNGTTFIILPD--------QGQMDTVVAALNRDTIDRW 281

  Fly   264 AALTL-QDVEIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYID 327
            ..|.: :.:.:::|:..:....||:.||..:||.::|::::  |...|::.........|:..:.
Mouse   282 GKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQS--DFADTTKDTPLTLTVLHKAMLQ 344

  Fly   328 VNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVF 363
            ::|.....||.:.   .|:.|.......|.:.||:|
Mouse   345 LDEGNVLPAATNG---PPVHLPSESFTLKYNRPFIF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 91/361 (25%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 89/359 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.