DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and Serpinb7

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_081824.1 Gene:Serpinb7 / 116872 MGIID:2151053 Length:380 Species:Mus musculus


Alignment Length:374 Identity:108/374 - (28%)
Similarity:173/374 - (46%) Gaps:46/374 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIALNFGEFWRTSCNYGDRGP---- 93
            |..||..|:.:||||..:||.|..|.::...|......|..             |..:..|    
Mouse    27 NVFFSSLSIFTALTLIRLGARGDCARQIDKALHFNIPSRQG-------------NSSNNQPGLQY 78

  Fly    94 ----VLKSVNRLYVNDSLELLT------------EFNEIAVDFFQSKAEATRFADSEGATQL-IN 141
                ||..:|..:.:..|.:.|            .:.|.|.:.:.:|.|...|.:....|:. ||
Mouse    79 QLKRVLADINSSHKDYELSIATGVFAEKVYDFHKNYIECAENLYNAKVERVDFTNDVQDTRFKIN 143

  Fly   142 DWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMM 206
            .|:|.||..||..:|...::::....:|:|.:||||||:..|....|....|.........||||
Mouse   144 KWIENETHGKIKKVLGDSSLSSSAVMVLVNAVYFKGKWKSAFTKTDTLSCRFRSPTCPGKVVNMM 208

  Fly   207 YQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADID--AALTLQ 269
            :||.:|..:.:.|...:.::|.| :..|.|.|:||.:  ||.|:|.:|:..:|.|..  ..:..|
Mouse   209 HQERRFNLSTIQQPPMQVLELQY-HGGISMYIMLPED--GLCEIESKLSFQNLMDWTNRRKMKSQ 270

  Fly   270 DVEIFLPRMCIEYDVDLKQVLNQLGITEVFSD-KAKLDGLFTSQSGQK--ISAARHRGYIDVNEA 331
            .|.:|||:..||.:.::...|..||:.::|.: .|.|.|:   .||.:  :|...|:.:|:|:|.
Mouse   271 YVNVFLPQFKIEKNYEMTHHLKSLGLKDIFDESSADLSGI---ASGGRLYVSKLMHKSFIEVSEE 332

  Fly   332 GSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQAVFFAGRFSNP 380
            |:||.|.:...||...| ....:|:||.||:|.|:....:.|.|:.|.|
Mouse   333 GTEATAATENNIVEKQL-PESTVFRADRPFLFVIKKNDIILFTGKVSCP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 106/369 (29%)
Serpinb7NP_081824.1 SERPIN 4..380 CDD:294093 107/372 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.