DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and LOC100909605

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006240581.2 Gene:LOC100909605 / 100909605 RGDID:6502633 Length:410 Species:Rattus norvegicus


Alignment Length:387 Identity:113/387 - (29%)
Similarity:179/387 - (46%) Gaps:66/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLG----------------------PGD 70
            |:|..|.|||..|:.:||.|..:||..:|.:|:..||:..                      |||
  Rat    55 KNPDKNIVFSSFSISTALVLLSLGAKNNTLKEILEGLKFNLTETPEAEIHQGYEHLLQRLNLPGD 119

  Fly    71 RHHIALNFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEG 135
            :..|:..                     :.|::...|::|.||.|.|...:|::|.:|.|.....
  Rat   120 QVQISTG---------------------SALFIKKHLQILAEFQEKARALYQAEAFSTDFQQPHE 163

  Fly   136 ATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTH 200
            |.:||||:|.::|:.||..|:  ..::.:||.:|:|.:||||||:.||.|..|....|::|....
  Rat   164 AKKLINDYVRKQTQGKIKELI--SVLDKKTSMVLVNYIYFKGKWKMPFDPHDTFQSEFYLDEKKS 226

  Fly   201 VQVNMM--------YQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTV 257
            |:|.||        |..|:       :|....::|.|. .|...|.:||:: ..:|::|..|...
  Rat   227 VKVPMMKIEKLTTPYFRDE-------ELSCSVLELKYT-GNASALFILPDQ-GRMQQVEASLQPE 282

  Fly   258 DLADIDAALTLQDV-EIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAAR 321
            .|......|..:.: |:.:|:..|..|:.|..:|.:|||.||||.:|.|..: |......:|...
  Rat   283 TLRRWKDTLRPRRIDELRMPKFSISTDMRLGDILPELGIREVFSQQADLSRI-TGAKDLSVSQVV 346

  Fly   322 HRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYI--RNPQAVFFAGRFSNPK 381
            |:..:||.|.|:||||.:.:||:||...........:.||:..|  .|.....|..:.:|||
  Rat   347 HKAVLDVTETGTEAAAATGVKIIPMCAKFYYVTMYFNRPFLMIISDTNTHIALFMAKVTNPK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 110/381 (29%)
LOC100909605XP_006240581.2 alpha-1-antitrypsin_like 41..404 CDD:239011 110/381 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.