DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpinh1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_002937290.2 Gene:serpinh1 / 100490491 XenbaseID:XB-GENE-1005105 Length:450 Species:Xenopus tropicalis


Alignment Length:379 Identity:100/379 - (26%)
Similarity:166/379 - (43%) Gaps:28/379 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPGDRHHIAL 76
            |.||...:.||...:      |.:.||..|.|:|.|..:|...|||.:.:..|........||..
 Frog    83 AFNLYQTMAKDKNVE------NILLSPVVVASSLGLVSLGGQASTAAQAKAVLSADKLSDEHIHS 141

  Fly    77 NFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLIN 141
            ...|......|...|....|..||||...|:....:|.:.:...:..:.....|.|.....:.||
 Frog   142 GLAELLNEVSNSTARNVTWKIGNRLYGPSSISFTDDFVKNSKKHYNYEHSKINFRDKRSTLRSIN 206

  Fly   142 DWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMM 206
            :|..|.|:.|:.. :.|| :.....||::|.::||..|.:.|..:......|.|.|...|.|.||
 Frog   207 EWASQATDGKLPE-VTSD-MERTDGALIVNAMFFKPHWDERFHHQMVDNRGFMVTRSFTVSVPMM 269

  Fly   207 YQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDV 271
            ::...:.:.|..:...:.:::|..:....||.::|:.|..|:.:|:.|....:......:|.:.|
 Frog   270 HRTGLYNYLEDEKNGLQILEMPLAHKLSSMLFIMPHHVEPLERVEKLLTREQVKTWVGKMTKKAV 334

  Fly   272 EIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQK---ISAARHRGYI----DVN 329
            .:.||::.:|...||::.|..||:||.. ||.|.|  .:..||:|   :::..|...:    |.|
 Frog   335 AVSLPKVSLEVSHDLQKHLGDLGLTEAI-DKTKAD--LSKISGKKDLYLASMFHAAALEWDTDGN 396

  Fly   330 EAGSEAAAVSFMKIVPMMLNMNKKLFKADHPFVFYIRNPQ--AVFFAGRFSNPK 381
            ...|:..:...::.        .|||..||||||.|::.:  ::.|.||...||
 Frog   397 PFDSDIYSREELRA--------PKLFYVDHPFVFLIKDEKTDSILFIGRLVRPK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 97/373 (26%)
serpinh1XP_002937290.2 serpinH1_CBP1 68..449 CDD:381003 100/379 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.