DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpina10

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_012824917.1 Gene:serpina10 / 100487295 XenbaseID:XB-GENE-983018 Length:437 Species:Xenopus tropicalis


Alignment Length:375 Identity:106/375 - (28%)
Similarity:170/375 - (45%) Gaps:58/375 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGP---------------------GDRHHIAL 76
            |..|||.||...|:...:|..|:|.::|.:||...|                     .....:.|
 Frog    91 NIFFSPFSVSLGLSSLLLGTRGNTYDQLLHGLNYNPFKDQENPYLLPELLKTIKEKIAKNEELVL 155

  Fly    77 NFGEFWRTSCNYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLIN 141
            |.|..                   .:::::..:..||..:...:|..:.|...|..|:...: ||
 Frog   156 NIGSL-------------------SFLHETFSMKDEFVNLTKKYFDMEYELIDFHSSKAKNE-IN 200

  Fly   142 DWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMM 206
            .:||:.|:..|:|..  |.::.:|..||::.::||||||.||.|..|.:|.|.:|:...|.|.||
 Frog   201 AYVEKLTKGLISNFY--DFIDPQTKLLLLDYIFFKGKWQYPFNPALTEVDSFFIDKYNSVTVPMM 263

  Fly   207 YQEDKFRFAELPQLKARAVQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDV 271
            |:.||........|.....:||| ..|.||||:.|.:......||..|....:....|.:..:..
 Frog   264 YKTDKVASVFDKDLSCTVFKLPY-RGNAHMLIIKPEKEGDFGILEDHLTKELINSWQAKMQSRKT 327

  Fly   272 EIFLPRMCIEYDVDLKQVLNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAA 336
            :||.|:..::....||..||:|||.|:|:.||.|..| |.:....::....:..|:|:|.|:|||
 Frog   328 DIFFPKFKLDQKYKLKSSLNELGIKELFTGKANLTDL-TEERNLMLTEITQQAMIEVDERGTEAA 391

  Fly   337 AVSFMKIV----PMMLNMNKKLFKADHPFVFYIRNP--QAVFFAGRFSNP 380
            ||:..:|:    |:.:.:|:       ||:|.|...  |::.|.||..:|
 Frog   392 AVAGAEIIAYSLPLTIRVNR-------PFLFMIFEEAYQSLLFLGRVMDP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 104/370 (28%)
serpina10XP_012824917.1 serpinA10_PZI 58..436 CDD:381011 106/375 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.