DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpine1

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_002941247.2 Gene:serpine1 / 100127732 XenbaseID:XB-GENE-969639 Length:403 Species:Xenopus tropicalis


Alignment Length:419 Identity:116/419 - (27%)
Similarity:183/419 - (43%) Gaps:88/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QEGRNQFARNLIDVITKDALQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLGPG 69
            |:| ..|...|...:..|  |..|    |..|||..|.|||::...||:|:|.:::|.       
 Frog    30 QKG-TSFGLRLFQEVLAD--QWGK----NLGFSPYGVTSALSVLQSGAAGTTLDQIRK------- 80

  Fly    70 DRHHIALNFG-EFWRTSC--------------NYGDRGPVLKSVNRLYVNDSLELLTEFNEIAVD 119
                 |||:| :.|..:.              :..|..|| ...:.|:|...|.|...|.:....
 Frog    81 -----ALNYGHKEWAVALALNKLREQISGQQKSAEDPKPV-HIADGLFVQRDLSLTPGFLQRFQA 139

  Fly   120 FFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQSDAVNNETSALLINVLYFKGKWQKPFM 184
            .|........|.|...|..:||.|||.:|:..|.:|:.|:.:...|..:|::.::|.|||..||:
 Frog   140 TFHRHLSQVNFTDVAQAKDIINQWVENKTDGMIKDLVGSNNIPPLTRLVLLSAVHFSGKWTVPFL 204

  Fly   185 PETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKA---RAVQLPYDYSNIHMLILLPNEVNG 246
            .:.|....|:....:||||.||....|:..:|......   ..::|||:...:.|||..|.|.| 
 Frog   205 EKATHQRPFYRSDGSHVQVQMMANTGKYNCSEFTTPDGDFYDVIELPYEGEELSMLIAAPYEKN- 268

  Fly   247 LQELEQQLNTVDLADIDAALTLQDVE------------IFLPRMCIEYDVDLKQVLNQLGITEVF 299
                      |.|:.|...||.:.:.            :.||:..:..:||||:.|.:||||::|
 Frog   269 ----------VPLSAITNILTPELIAQWKAQMKKVTRLLVLPKFSLLSEVDLKKPLERLGITDMF 323

  Fly   300 ----SDKAKLDG---LFTSQSGQKISAARHRGYIDVNEAGSEA----AAVSFMKIVPMMLNMNKK 353
                :|.::|..   |:.|::.|||.       ::|.|.|:.|    ||:...::.|:.:.|   
 Frog   324 TQETADFSRLSSEKPLYVSEAFQKIK-------VEVTEKGTRASAATAAILLARMAPLEVIM--- 378

  Fly   354 LFKADHPFVFYIR-NPQ-AVFFAGRFSNP 380
                ||||:|.:| ||. .:.|.|:...|
 Frog   379 ----DHPFLFMVRHNPTGTLLFVGQVMEP 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 114/412 (28%)
serpine1XP_002941247.2 SERPIN 22..403 CDD:294093 115/417 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.