DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Dc and serpina10b

DIOPT Version :9

Sequence 1:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:353 Identity:107/353 - (30%)
Similarity:174/353 - (49%) Gaps:18/353 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NTVFSPASVQSALTLAFMGASGSTAEELRNGLQ---LGPGDRHHIALNFGEFWRTSCNYGDRGPV 94
            |.||||.||.:..:...:.|.|||..|:..||.   |..||...:...|.:..:......::|  
Zfish    53 NVVFSPLSVSTCFSALLLAAQGSTRTEILKGLNLEALDGGDSRRVPELFQQLHQNISLQMEQG-- 115

  Fly    95 LKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFADSEGATQLINDWVEQETEHKITNLLQSD 159
                ..|:::....|.|.|::....||.::.....|:.......|||::|.::|..|:..:|:| 
Zfish   116 ----TALFLDQHFHLQTNFSQQIQRFFNAEVLRVDFSKPAVCRSLINEFVSRKTGRKVLEMLES- 175

  Fly   160 AVNNETSALLINVLYFKGKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARA 224
             |...|..||:|.:::||.|::||.|..|....|:||:...|||.||..|:||...|...|:||.
Zfish   176 -VEPLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKYNIVQVPMMMLEEKFSVVEDRDLRARV 239

  Fly   225 VQLPYDYSNIHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQV 289
            ::||| .....||||||:.......:|.:::...|......:....:|:.|||..::....:.::
Zfish   240 LRLPY-RGGASMLILLPSADADYTAIEDEISAERLHGWIKNMRRMKMEVHLPRFRMDQSYHMHEL 303

  Fly   290 LNQLGITEVFSDKAKLDGLFTSQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKL 354
            |.||||:.||.|.|.|.|| :..:..|:|...|:..|:|.|.|:.||:.:.:.|....|   ...
Zfish   304 LPQLGISSVFQDSADLTGL-SRDAHLKVSQVLHKAVIEVYEQGTSAASSTSVGITAYSL---PDT 364

  Fly   355 FKADHPFVFYIRNPQ--AVFFAGRFSNP 380
            |..:.||.|::.:.:  ::.|.||..:|
Zfish   365 FIINRPFFFFLYHEETASLLFMGRVIDP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 105/348 (30%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 106/351 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.