DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and Serpinb6c

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001369781.1 Gene:Serpinb6c / 97848 MGIID:2145481 Length:379 Species:Mus musculus


Alignment Length:360 Identity:113/360 - (31%)
Similarity:186/360 - (51%) Gaps:29/360 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGLEAQQ---VAESFGVVLKSYEQCQV-- 88
            |:..||:||..:..|:.:|..  ..||.::.:.|..|...:.:   |.:.|.::|....:...  
Mouse    27 NVFLSPISISSALVMVLLGAK--GTTAIQITQALSLGKCSSSEDGDVHQGFQLLLSEVNKTGTQY 89

  Fly    89 -LKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDF--GSEQAASIINKWVESQTNNLIKDIIG 150
             ||.||.|:..|...:...|.....:.:.::..|:||  .:||:...||.||..:|.:.||:::.
Mouse    90 SLKAANRLFGEKTFDILASFKDSCHKFYEAEMEELDFKGATEQSRQHINTWVAKKTEDKIKELLS 154

  Fly   151 PRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS---DRPTRVRMMHVCENFFFAVLPMF 212
            |..:..::.|.|||.::|||:|...||:::|||..|..|   ::|  |:||.....|....:...
Mouse   155 PGTIHSNTPLILVNAVYFKGKWEKQFNKEDTREMPFKVSKNEEKP--VQMMFQKSTFKMTYVEEI 217

  Fly   213 EATALRMNYSACNLAMIILLPDEKSNLTSLEKKLS-DISLEVVS-SAMNLEKVDVKIPSFTAEFQ 275
            ....|.:.|....|.|||:||||...|:::||::: :..:|... ..|..|||:|.:|.|..|..
Mouse   218 STKILLLPYVGNELNMIIMLPDEHVELSTVEKEITHEKFIEWTRLDRMKGEKVEVFLPWFKLEEN 282

  Fly   276 QELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAV--ATF 337
            .::..||..:||...| .|:|:..| :.|::.||:|.::||:.:|:||.|:||.|||..|  .:.
Mouse   283 YDMKDVLCKLGMTDAFEEGRADFSG-ISSKQGLFLSNVIHKSVVEVNEEGSEATAATTIVLKGSS 346

  Fly   338 RSMPARQGPPKVFHANRPFFYAIKD-NTHGLLFAG 371
            ||.|.       |..||||.:.|:. .|:.:||.|
Mouse   347 RSTPC-------FCVNRPFIFFIQHIKTNEILFLG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 113/360 (31%)
Serpinb6cNP_001369781.1 serpin 2..379 CDD:422956 113/360 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.