DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINB11

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:386 Identity:113/386 - (29%)
Similarity:197/386 - (51%) Gaps:34/386 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLRFGGL--------- 67
            :|.|.:...|...:.|.||.:|.||:..:.:|:.:|..  ..|.:::::.|.|...         
Human    10 EFCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGAR--GETEEQLEKVLHFSHTVDSLKPGFK 72

  Fly    68 ------EAQQVAESFGVVLKSYEQ----CQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEI 122
                  :|.::...|||......|    | .|.:||.||..|.:...:|:....|:.::::...:
Human    73 DSPKCSQAGRIHSEFGVEFSQINQPDSNC-TLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQTV 136

  Fly   123 DF--GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREED 185
            ||  .:|:....||.|||::||..:.::.|...:...|.:.|||.|:|||:|...|..:||.:..
Human   137 DFEQSTEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRETVKSP 201

  Fly   186 F-FGSDRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDI 249
            | ....:...|.||:....|..|.:...:...|.:.|....|:||||||...:||..:||:|:..
Human   202 FQLSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLKQIEKQLNSG 266

  Fly   250 SLEVVSSAMNL--EKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSG-QAELGGMLQSEESLFVSQ 311
            :....:|:.|:  .:|:|.:|.|..|.:.||:.:|..:|:..:|:. :|:|.|| ...:.|::|:
Human   267 TFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGM-SPTKGLYLSK 330

  Fly   312 IVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIK-DNTHGLLFAG 371
            .:||::::::|.||||||||......:|:|.|    ..|.||.||.:.|: .:|:.:||.|
Human   331 AIHKSYLDVSEEGTEAAAATGDSIAVKSLPMR----AQFKANHPFLFFIRHTHTNTILFCG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 113/386 (29%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 113/386 (29%)
RCL. /evidence=ECO:0000250 341..365 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.