DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINB7

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:367 Identity:109/367 - (29%)
Similarity:189/367 - (51%) Gaps:42/367 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NIIYSPLSIHISAAMLRMGTSEGSATAKEMDEGLR------FG-------GLEAQ--QVAESFGV 78
            |:.:|.||:..:.|::|:|..:.|.:  ::|:.|.      :|       ||::|  :|......
Human    27 NVFFSSLSLFAALALVRLGAQDDSLS--QIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINA 89

  Fly    79 VLKSYEQCQVLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGS--EQAASIINKWVESQT 141
            ..|.|:    |.:.|||:..|.....:.:....|:.:.:|...:||.:  |.....||||||::|
Human    90 SHKDYD----LSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTRRNINKWVENET 150

  Fly   142 NNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGSDRPTR-VRMMHVCENFF 205
            :..||::||...::..:.:.|||.::|||:|..:|.:.||....|.......: |.|||....|.
Human   151 HGKIKNVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKAVAMMHQERKFN 215

  Fly   206 FAVL--PMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVVSS--AMNLEKVDVK 266
            .:|:  |..:...||.|   ..:.|.:|||:  ::|:.:|.||:..:|...::  .|..:.|:|.
Human   216 LSVIEDPSMKILELRYN---GGINMYVLLPE--NDLSEIENKLTFQNLMEWTNPRRMTSKYVEVF 275

  Fly   267 IPSFTAEFQQELSQVLMLMGMNRIF-SGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAA 330
            .|.|..|...|:.|.|..:|:..|| ..:|:|.| :.|...|::|:::||::||:.|.||||.||
Human   276 FPQFKIEKNYEMKQYLRALGLKDIFDESKADLSG-IASGGRLYISRMMHKSYIEVTEEGTEATAA 339

  Fly   331 TAAVATFRSMPARQGPPKVFHANRPFFYAI-KDNTHGLLFAG 371
            |.:....:.:|    ...:|.|:.||.:.| ||:.  :||:|
Human   340 TGSNIVEKQLP----QSTLFRADHPFLFVIRKDDI--ILFSG 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 109/367 (30%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 109/367 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.