DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and SERPINH1

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001193943.1 Gene:SERPINH1 / 871 HGNCID:1546 Length:418 Species:Homo sapiens


Alignment Length:388 Identity:93/388 - (23%)
Similarity:163/388 - (42%) Gaps:37/388 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EFAQGLEQFALCLHDHLCRASAGLNIIYSPLSIHISAAMLRMGTSEGSA-TAKEMDEGLRFGGLE 68
            |.:.||   |..|:..:.:..|..||:.||:.:..|..::.:|   |.| ||.:....|....|.
Human    45 ERSAGL---AFSLYQAMAKDQAVENILVSPVVVASSLGLVSLG---GKATTASQAKAVLSAEQLR 103

  Fly    69 AQQVAESFGVVLKSYEQCQ----VLKMANGLYVMKGLQVDEQFGHILEQKFRSKPMEIDFGSEQA 129
            .::|....|.:|:|.....    ..|:.:.||....:...:.|....:|.:..:..:|:|..:::
Human   104 DEEVHAGLGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRS 168

  Fly   130 A-SIINKWVESQTNNLIKDIIGPRVLTKD----SRLCLVNGIHFKGEWSISFNEKETREEDFFGS 189
            | ..||:|....|:..:.::      |||    ....|||.:.||..|...|:.|......|..:
Human   169 ALQSINEWAAQTTDGKLPEV------TKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVT 227

  Fly   190 DRPT-RVRMMH--VCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISL 251
            ...| .|.|||  ...|::.......:...:.:.:...:|  |||:|.....|..|||.|:...|
Human   228 RSYTVGVMMMHRTGLYNYYDDEKEKLQIVEMPLAHKLSSL--IILMPHHVEPLERLEKLLTKEQL 290

  Fly   252 EVVSSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNR-IFSGQAELGGMLQSEESLFVSQIVHK 315
            ::....|..:.|.:.:|....|...:|.:.|..:|:.. |...:|:|..| ..::.|:::.:.|.
Human   291 KIWMGKMQKKAVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRM-SGKKDLYLASVFHA 354

  Fly   316 AFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFHANRPFFYAIKDNTHG-LLFAGHFITTK 377
            ...|::..|.............||       ||:|:|:.||.:.::|...| |||.|..:..|
Human   355 TAFELDTDGNPFDQDIYGREELRS-------PKLFYADHPFIFLVRDTQSGSLLFIGRLVRPK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 89/375 (24%)
SERPINH1NP_001193943.1 serpinH1_CBP1 36..417 CDD:381003 93/388 (24%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 415..418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.