DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and AT1G64010

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001320592.1 Gene:AT1G64010 / 842704 AraportID:AT1G64010 Length:199 Species:Arabidopsis thaliana


Alignment Length:216 Identity:62/216 - (28%)
Similarity:100/216 - (46%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 IHFKGEWSISFNEKETREEDFF---GSDRPTRVRMMHVCENFFFAVLPMFEATAL---RMNYSAC 224
            ::|||.|...|::..|::.||.   |:.  ..|.:|...::.:......|:...|   :.|.::.
plant     1 MYFKGAWEEKFHKSMTKDRDFHLINGTS--VSVSLMSSYKDQYIEAYDGFKVLKLPFRQGNDTSR 63

  Fly   225 NLAMIILLPDEKSNLTSLEKKLSDISLEVVSSAMNLEKVDV---KIPSFTAEFQQELSQVLMLMG 286
            |.:|...|||||..|.:|.:|::. |:..:.|.:..:||.|   .||.|..||....|:....:|
plant    64 NFSMHFYLPDEKDGLDNLVEKMAS-SVGFLDSHIPSQKVKVGEFGIPKFKIEFGFSASRAFNRLG 127

  Fly   287 MNRIFSGQAELGGMLQSEESLFVSQIVHKAFIEINEVGTEAAAATAAVATFRSMPARQGPPKVFH 351
            ::               |.:|:     .||.:||:|.|.||.||||.|..|.....::..   |.
plant   128 LD---------------EMALY-----QKACVEIDEEGAEAIAATAVVGGFGCAFVKRID---FV 169

  Fly   352 ANRPFFYAIK-DNTHGLLFAG 371
            |:.||.:.|: |.|..:||.|
plant   170 ADHPFLFMIREDKTGTVLFVG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 62/216 (29%)
AT1G64010NP_001320592.1 serpin <1..195 CDD:393296 62/216 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I1521
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1112
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.