DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn42Db and AT1G51330

DIOPT Version :9

Sequence 1:NP_610244.2 Gene:Spn42Db / 35599 FlyBaseID:FBgn0033112 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_175544.1 Gene:AT1G51330 / 841556 AraportID:AT1G51330 Length:193 Species:Arabidopsis thaliana


Alignment Length:212 Identity:46/212 - (21%)
Similarity:71/212 - (33%) Gaps:76/212 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 GSEQAASIINKWVESQTNNLIKDIIGPRVLTKDSRLCLVNGIHFKGEWSISFNEKETREEDFFGS 189
            |:|:....:|.|....||.|||:::.|..:|..:.....|.::|||.|...|.:..|..:.|   
plant    31 GAEEVRMEVNSWALRHTNGLIKNLLPPGSVTNQTIKIYGNALYFKGAWENKFGKSMTIHKPF--- 92

  Fly   190 DRPTRVRMMHVCENFFFAVLPMFEATALRMNYSACNLAMIILLPDEKSNLTSLEKKLSDISLEVV 254
                     |:..                        ...:|:|..|    |.|:|        .
plant    93 ---------HLVN------------------------GKQVLVPFMK----SYERK--------Y 112

  Fly   255 SSAMNLEKVDVKIPSFTAEFQQELSQVLMLMGMNRIFSGQAELGGMLQSEESLFVSQIVHKAFIE 319
            ..|.|..|| ::|..:..:::....|..:.|.:|                           ..||
plant   113 MKAYNGFKV-LRILQYRVDYKDTSRQFSIDMDLN---------------------------VLIE 149

  Fly   320 INEVGTEAAAATAAVAT 336
            |:|...|||||||...|
plant   150 IDEESAEAAAATALACT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn42DbNP_610244.2 SERPIN 12..373 CDD:238101 46/212 (22%)
AT1G51330NP_175544.1 SERPIN <11..>139 CDD:294093 32/156 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.